Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate AG28 coat protein gene, complete cds.

ACC No: KC590498

Dated: 2013-03-19 | Length: 672 | CRC: 927979920

                
ID   KC590498; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   KC590498;
XX
DT   19-MAR-2013 (Rel. 116, Created)
DT   19-MAR-2013 (Rel. 116, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate AG28 coat protein gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Biswas K.K., Khatun D., Tarafdar A.;
RT   "Characterization of Citrus tristeza virus and determination of genetic
RT   variability in Northeast and South India";
RL   Unpublished.
XX
RN   [2]
RP   1-672
RA   Biswas K.K., Khatun D., Tarafdar A.;
RT   ;
RL   Submitted (08-FEB-2013) to the INSDC.
RL   Advanced Centre for Plant Virology, Division of Plant Pathology, Indian
RL   Agricultural Research Institute, Pusa Campus, New Delhi, Delhi 110012,
RL   India
XX
CC   ##Assembly-Data-START##
CC   Sequencing Technology :: Sanger dideoxy sequencing
CC   ##Assembly-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /host="Citrus reticulata (Khasi mandarin)"
FT                   /isolate="AG28"
FT                   /mol_type="genomic RNA"
FT                   /country="India:Dhuliajan, Tinsukia, Assam"
FT                   /collected_by="K K Biswas"
FT                   /collection_date="Apr-2010"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /note="ORF7"
FT                   /protein_id="AGH18413.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVAAAESSFRSMNLHIDPTLIAMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKYPNLPDKDKDFHLAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGIEVDLSDKLWTDVVFNSKGIGNRSNALRVWGRTNDALYLAFCRQIPNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGGGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 194 A; 121 C; 174 G; 183 T; 0 other;

kc590498 Length: 672  19-MAR-2013  Type: N  Check: 3294  ..

       1  atggacgacg agacaaagaa attgaagaac aaaaacaagg agacgaaaga
      51  aggcgacgat gttgcagcag cagaatcttc ttttcgttcc atgaacttac
     101  acatagatcc gactctgata gcgatgaacg atgtgcgtca gttgggaacc
     151  caacagaacg ccgctttgaa cagagatttg tttcttactc tgaaagggaa
     201  gtatcctaac ttgcctgaca aggataagga ctttcactta gctatgatgt
     251  tatatcgttt agcggttaag agttcatcat tgcaaagtga tgacgacacc
     301  acgggcataa catatactcg ggagggtatt gaagtggatt tgtctgacaa
     351  gctttggact gacgtcgtgt ttaactctaa gggtattggt aaccgtagta
     401  atgcccttcg agtctggggt aggactaacg atgcccttta tttagctttc
     451  tgtagacaga ttcccaattt gagttatggt ggacgtccgc tagatgcagg
     501  gattccggct ggatatcatt acctatgtgc agatttcttg accggaggtg
     551  gcttgactga tttagaatgt gctgtgtaca tacaagctaa ggaacaattg
     601  ttgaagaagc gaggggctga tgaagtcgta gttactaatg tcaggcagct
     651  tgggaaattt aacacacgtt ga