Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate TP4 coat protein gene, complete cds.

ACC No: KC590502

Dated: 2013-03-19 | Length: 672 | CRC: 1451873293

                
ID   KC590502; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   KC590502;
XX
DT   19-MAR-2013 (Rel. 116, Created)
DT   19-MAR-2013 (Rel. 116, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate TP4 coat protein gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Tarafdar A., Khatun D., Biswas K.K.;
RT   "Characterization of Citrus tristeza virus and determination of genetic
RT   variability in Northeast and South India";
RL   Unpublished.
XX
RN   [2]
RP   1-672
RA   Tarafdar A., Khatun D., Biswas K.K.;
RT   ;
RL   Submitted (08-FEB-2013) to the INSDC.
RL   Advanced Centre for Plant Virology, Division of Plant Pathology, Indian
RL   Agricultural Research Institute, Pusa Campus, New Delhi, Delhi 110012,
RL   India
XX
CC   ##Assembly-Data-START##
CC   Sequencing Technology :: Sanger dideoxy sequencing
CC   ##Assembly-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /host="Citrus aurantifolia (Kagzi lime)"
FT                   /isolate="TP4"
FT                   /mol_type="genomic RNA"
FT                   /country="India:Tirupati"
FT                   /collected_by="K K Biswas"
FT                   /collection_date="Oct-2010"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /note="ORF7"
FT                   /protein_id="AGH18417.1"
FT                   /translation="MDDETKKLKNKTKEPKEGDNVVAAESSFGFVNLNIDPTLIAMNDV
FT                   LKLGTQQNAALNRDLFLTLKGKYPNLSDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGVT
FT                   YTREGVEVDLSDKLWTDVVFGSKGIGNRTNALRVWGRTNDALYLAFCIQNRNLSYGGRP
FT                   LDAGIPAGYPYPCAISLTGAGLTDLESAVYLQAKEQLLKKGGPDEVVVTNVRQLGEFNT
FT                   R"
XX
SQ   Sequence 672 BP; 189 A; 126 C; 177 G; 180 T; 0 other;

kc590502 Length: 672  19-MAR-2013  Type: N  Check: 5548  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaccaagg aaccgaaaga
      51  aggcgacaat gtcgttgcgg ccgagtcttc tttcggtttt gtaaatttaa
     101  acatcgatcc gactctgata gcgatgaacg atgtgctaaa gttgggtacc
     151  caacagaatg ctgctttgaa tagagatttg tttcttacct tgaaagggaa
     201  gtatcctaac ctctccgaca aagataaaga ctttcacata gctatgatgt
     251  tatatcgttt agcggttaag agttcatcgt tacaaagcga cgatgatacc
     301  acgggtgtga cgtacactcg ggagggtgtt gaagtggatt tgtctgacaa
     351  actttggaca gacgtcgtgt ttgggtctaa gggtattggt aaccgtacta
     401  acgcccttcg agtctggggt agaactaacg atgcccttta tttggctttt
     451  tgtatacaga accgcaattt gagttatggg ggacgtccgc tagatgcagg
     501  aattccggcc gggtatccct acccgtgtgc gatttccttg accggagctg
     551  gcttgactga tttagaaagt gcagtgtact tacaggctaa agagcaatta
     601  ttaaagaagg gagggcctga tgaggtcgta gttactaatg tcaggcagct
     651  tggggaattc aacacacgtt ga