Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate TP12 coat protein gene, complete cds.

ACC No: KC590509

Dated: 2013-03-19 | Length: 672 | CRC: 283563567

                
ID   KC590509; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   KC590509;
XX
DT   19-MAR-2013 (Rel. 116, Created)
DT   19-MAR-2013 (Rel. 116, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate TP12 coat protein gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Tarafdar A., Godara S., Biswas K.K.;
RT   "Characterization of Citrus tristeza virus and determination of genetic
RT   variability in Northeast and South India";
RL   Unpublished.
XX
RN   [2]
RP   1-672
RA   Tarafdar A., Godara S., Biswas K.K.;
RT   ;
RL   Submitted (08-FEB-2013) to the INSDC.
RL   Advanced Centre for Plant Virology, Division of Plant Pathology, Indian
RL   Agricultural Research Institute, Pusa Campus, New Delhi, Delhi 110012,
RL   India
XX
CC   ##Assembly-Data-START##
CC   Sequencing Technology :: Sanger dideoxy sequencing
CC   ##Assembly-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /host="Citrus sinensis (sweet orange)"
FT                   /isolate="TP12"
FT                   /mol_type="genomic RNA"
FT                   /country="India:Tirupati"
FT                   /collected_by="K K Biswas"
FT                   /collection_date="Oct-2010"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /note="ORF7"
FT                   /protein_id="AGH18424.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVVAAESSFGSVNLHIDPTLITMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKYPSLSDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLSDKLWTDVVFNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 192 A; 123 C; 176 G; 181 T; 0 other;

kc590509 Length: 672  19-MAR-2013  Type: N  Check: 4980  ..

       1  atggacgacg aaacaaagaa actgaagaac aaaaacaagg agacgaaaga
      51  aggcgatgat gttgttgcag cagagtcttc tttcggttcc gtgaacttac
     101  acattgatcc aactctgata acgatgaacg atgtgcgtca gttgggaacc
     151  caacagaacg ccgctttgaa cagagatttg tttcttactc tgaaagggaa
     201  gtatcctagc ttgtctgaca aggataagga cttccacata gctatgatgt
     251  tatatcgttt agcggttaag agttcatcgt tgcaaagtga cgacgacacc
     301  acgggcataa catatactcg ggagggtgtt gaagtggatt tgtctgacaa
     351  gctttggact gacgtcgtgt ttaactctaa gggtattggt aaccgtacta
     401  atgcccttcg agtctggggt aggactaacg atgcccttta tttagctttc
     451  tgtagacaga atcgcaattt gagttatggt ggacgtccgc tagatgcagg
     501  gattccggct ggataccatt acctatgtgc agatttcttg actggagctg
     551  gcttgactga tttagaatgt gctgtgtaca tacaagctaa ggaacaattg
     601  ttgaagaagc gaggggccga tgaagtcgta gttactaatg tcaggcagct
     651  tgggaaattt aacacacgtt ga