Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate K13 coat protein gene, complete cds.

ACC No: KC694144

Dated: 2013-03-19 | Length: 672 | CRC: 117797543

                
ID   KC694144; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   KC694144;
XX
DT   19-MAR-2013 (Rel. 116, Created)
DT   19-MAR-2013 (Rel. 116, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate K13 coat protein gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Divedi S., Tarafdar A., Biswas K.K.;
RT   "Characterization of Citrus tristeza virus and determination of genetic
RT   variability in Northeast and South India";
RL   Unpublished.
XX
RN   [2]
RP   1-672
RA   Divedi S., Tarafdar A., Biswas K.K.;
RT   ;
RL   Submitted (21-FEB-2013) to the INSDC.
RL   Advanced Centre for Plant Virology, Division of Plant Pathology, Indian
RL   Agricultural Research Institute, Pusa Campus, New Delhi, Delhi 110012,
RL   India
XX
CC   ##Assembly-Data-START##
CC   Sequencing Technology :: Sanger dideoxy sequencing
CC   ##Assembly-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /host="Citrus reticulata (Khasi mandarin)"
FT                   /isolate="K13"
FT                   /mol_type="genomic RNA"
FT                   /country="India:Tista Valley, Darjeeling"
FT                   /collected_by="K K Biswas"
FT                   /collection_date="2007"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /note="ORF7"
FT                   /protein_id="AGH18429.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVAAAESSFGSVNLHIDPTLIAMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKYPNLPDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGVT
FT                   YTRDGVEVDLSDKLWTDVVFNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 196 A; 125 C; 171 G; 180 T; 0 other;

kc694144 Length: 672  19-MAR-2013  Type: N  Check: 2941  ..

       1  atggacgacg aaacaaagaa actgaagaac aaaaacaagg aaacgaaaga
      51  aggcgacgat gttgctgcag ctgagtcttc tttcggttcc gtaaatttac
     101  acatcgatcc gactctgata gcgatgaacg atgtgcgtca gttgggtacc
     151  caacagaatg ctgctttgaa cagagatttg tttcttacct tgaaagggaa
     201  gtatcctaac ttacctgaca aagacaaaga ctttcatata gctatgatgt
     251  tatatcgttt agcggttaag agttcatcat tacaaagcga cgatgacacc
     301  acgggtgtaa cgtacactcg agacggtgtt gaagtggatt tgtctgacaa
     351  gctttggact gacgtagtgt ttaactctaa gggtattggt aaccgcacta
     401  acgcccttcg agtctggggt agaactaacg atgcccttta tttggctttt
     451  tgtagacaga accgcaattt gagttatggt ggacgtccgt tagatgcggg
     501  aattccagcc gggtatcact acctgtgtgc agatttcttg accggagctg
     551  gcttgactga tttggaatgt gcagtgtaca tacaagctaa agagcaatta
     601  ttaaagaagc gaggggctga tgaggtcgta gttactaatg tcaggcagct
     651  tgggaaattt aacacacgtt ga