Sequence of DPV Hibiscus chlorotic ringspot virus

Hibiscus chlorotic ringspot virus isolate HCRSV-Is, complete genome.

ACC No: KC876666

Dated: 2013-06-16 | Length: 3908 | CRC: 353084294

                
ID   KC876666; SV 1; linear; genomic RNA; STD; VRL; 3908 BP.
XX
AC   KC876666;
XX
DT   16-JUN-2013 (Rel. 117, Created)
DT   16-JUN-2013 (Rel. 117, Last updated, Version 1)
XX
DE   Hibiscus chlorotic ringspot virus isolate HCRSV-Is, complete genome.
XX
KW   .
XX
OS   Hibiscus chlorotic ringspot virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Carmovirus.
XX
RN   [1]
RP   1-3908
RA   Luria N., Reingold V., Lachman O., Dombrovsky A.;
RT   "Hibiscus Chlorotic Ringspot Virus Israeli isolate";
RL   Unpublished.
XX
RN   [2]
RP   1-3908
RA   Luria N., Reingold V., Lachman O., Dombrovsky A.;
RT   ;
RL   Submitted (09-APR-2013) to the INSDC.
RL   Plant Pathology, ARO, The Volcani Center, Bet Dagan, 1 Hamacabim St.,
RL   Rishon Le-Zion, Bet-Dagan 50250, Israel
XX
CC   ##Assembly-Data-START##
CC   Sequencing Technology :: Sanger dideoxy sequencing
CC   ##Assembly-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .3908
FT                   /organism="Hibiscus chlorotic ringspot virus"
FT                   /host="Hibiscus rosa-sinensis"
FT                   /isolate="HCRSV-Is"
FT                   /mol_type="genomic RNA"
FT                   /country="Israel"
FT                   /isolation_source="leaf"
FT                   /collection_date="15-Feb-2012"
FT                   /db_xref="taxon:53181"
FT   gene            31. .2238
FT                   /gene="RdRpP81"
FT   CDS             31. .2238
FT                   /codon_start=1
FT                   /transl_except=(pos:673. .675,aa:OTHER)
FT                   /gene="RdRpP81"
FT                   /product="RNA-dependent RNA polymerase P81"
FT                   /protein_id="AGN70380.1"
FT                   /translation="MLTHAFSIAFETVSLGAALCVAPFAAAVEIVTHPRIAPRDPCVAE
FT                   ELCMRDELEVVDPTDEEPEACLENIPGSSGDKKVSKIKRRHRGKFALHAAIAAKLHFGG
FT                   TPTPTRSNELAVRRWLASYCKERRLVDTHALQAIALATPLVLTPGAAEITERAILNSAV
FT                   FGMRRAALAEASKPTSLGYQMVFEPHRPRTWLRAWRKVVGLPDFQGYSPVKXGCLREIA
FT                   GVDTKIVRGEHQSMAVFPREGISKPRRIFQVCGMGNGTTFGVHNNSLTNLRRGLVERVF
FT                   YVEDACKNLVPTPRPLPGKFQELKYLARRVARIAGHHTPIPREQYPGLYKGRRYQIYAD
FT                   AVNSLASNPVHRRDSFLKTFVKAEKINFSAKPDPAPRVIQPRDPRYNVEVGRYLKPYEH
FT                   HLYRALDVVWKGPTVLKGYTVSEIGSIMHSHWSQFQKPCAVGFDMKRFDQHVSVDALRF
FT                   EHSVYGRSFCSKELDRLLEWQLLNSGVGHANDGYIRYKVDGCRMSGDVNTAMGNCLLAC
FT                   LITKHLLKGIRCRLINNGDDCVLFFNTPDLAAVTERLAHWLDFGFQCVVEEPVYELEEV
FT                   EFCQMKPVFDGEEWVCVRNVHVSVAKDTYSINPWNNENDAGRWIRAIGECGEALTGGIP
FT                   VLNAYYKVFKRAYKAPGKVKESLAFDSGMYRLSQRCSRSFHEPTEEARVSFFKAFGVDP
FT                   MAQMAIEEFYDSLDIELEFAPEGKLDDISLLWLLRKRMIAS"
FT   gene            31. .675
FT                   /gene="P28"
FT   CDS             31. .675
FT                   /codon_start=1
FT                   /gene="P28"
FT                   /product="P28 protein"
FT                   /note="unknown function"
FT                   /protein_id="AGN70379.1"
FT                   /translation="MLTHAFSIAFETVSLGAALCVAPFAAAVEIVTHPRIAPRDPCVAE
FT                   ELCMRDELEVVDPTDEEPEACLENIPGSSGDKKVSKIKRRHRGKFALHAAIAAKLHFGG
FT                   TPTPTRSNELAVRRWLASYCKERRLVDTHALQAIALATPLVLTPGAAEITERAILNSAV
FT                   FGMRRAALAEASKPTSLGYQMVFEPHRPRTWLRAWRKVVGLPDFQGYSPVK"
FT   gene            41. .670
FT                   /gene="P23"
FT   CDS             41. .670
FT                   /codon_start=1
FT                   /gene="P23"
FT                   /product="P23 protein"
FT                   /protein_id="AGN70382.1"
FT                   /translation="MLSQLLSKLSLSVRHYVSRLSPQLLKLLHTHVSPHGILASLKNCV
FT                   CAMSLRLLIPLMRNLKLVWRIFPVLQAIRKCLRSRGDIGVSLRSMRLSQQSYTLGVLQP
FT                   QRARMSLLCDGGLQVIARKGGWLTHTLYKRSLWPLLWYLRQGPLKSLKERSLIVLSSVC
FT                   GERLLLKPLSRLVSDTRWCLSHIGRGLGLGPGGKWWVSLIFRGTRP"
FT   gene            2205. .2417
FT                   /gene="P8"
FT   CDS             2205. .2417
FT                   /codon_start=1
FT                   /gene="P8"
FT                   /product="putative movement protein P8"
FT                   /protein_id="AGN70381.1"
FT                   /translation="MASTQTNDSFIELNPHDTGHNKGAGKGNRQAKKEVALQAVHKANK
FT                   QDEAISGGSFVFVADKVEVTININF"
FT   gene            2344. .2684
FT                   /gene="P9"
FT   CDS             2344. .2580
FT                   /codon_start=1
FT                   /gene="P9"
FT                   /product="P9 protein"
FT                   /protein_id="AGN70383.1"
FT                   /translation="MKLFLGVLLFLLLIKLRLPLTSTFDIDLRTLRENCFIIATLSLFG
FT                   FFITVLIKAESEHHHFHSHDSSKTQNIVVNTGK"
FT   gene            2587. .3624
FT                   /gene="P38"
FT   CDS             2587. .3624
FT                   /codon_start=1
FT                   /gene="P38"
FT                   /product="coat protein P38"
FT                   /protein_id="AGN70384.1"
FT                   /translation="MVQKNVPAVQSAFKAHFPWAIKIKTDGWAVLFKGQKGAANRYAGG
FT                   TRPVTSQIKLSTLKVTAPVAASMRTRNPGANIRTAGKSVTVVHCEFVGNIARQTGSGLL
FT                   VVERTINPSNVLSFPWLSVLAAGYEKYRVSSLSLRYSPTCATTTEGKVILAFDKDAADA
FT                   SPTSKSDMYNHDGAVGVSPWDSAMLQIPCDNVDRFINDSSSSDPKLVDFGKVVVANYGQ
FT                   SEGDVDVIGELFLQYSVTLKIPQGTATLTQSGVGISSVGPSLFRVQLRDGTYVFTCNGT
FT                   GRFLFFFNSTVDATSTIAGMEVKQKSSTDDKGETTIMELLATESGGMIAIMVATGTLTW
FT                   WACRN"
FT   gene            2600. .3274
FT                   /gene="P25"
FT   CDS             2600. .3274
FT                   /codon_start=1
FT                   /gene="P25"
FT                   /product="P25 protein"
FT                   /protein_id="AGN70385.1"
FT                   /translation="MSQPFKVRLKPIFPGQSKLRRMGGLFFLRVKRGQPIDTRVEPVLL
FT                   LLKLSCQHLRLQLRWPPRCGLVTLEQTLGRLENRSLSSIASLWAISPGRLVVGYWWSRE
FT                   RLTPATYSASPGFLYLLPDMRSTACHHYLFDILQLAPLRRRARSSWHLIKMLQMLPLPP
FT                   RATCITMMEQLESRPGIVPCCKYLVIMWIGLLMIPVVPTLSLLTLVRWLLPIMANLKGM
FT                   WM"
XX
SQ   Sequence 3908 BP; 965 A; 900 C; 1027 G; 1016 T; 0 other;

kc876666 Length: 3908  16-JUN-2013  Type: N  Check: 4457  ..

       1  gggaaaccgt ggcaagtttc cgaacgctcc atgcttactc atgctttctc
      51  aattgctttc gaaactgtct ctctcggtgc ggcactatgt gtcgcgcctt
     101  tcgccgcagc tgttgaaatt gttacacacc cacgtatcgc cccacgggat
     151  ccttgcgtcg ctgaagaatt gtgtatgcgc gatgagcttg aggttgttga
     201  tcccactgat gaggaacctg aagcttgtct ggagaatatt cccggttctt
     251  caggcgataa gaaagtgtct aagatcaaga ggcgacatag gggtaagttt
     301  gcgctccatg cggctatcgc agcaaagcta cactttgggg gtactccaac
     351  cccaacgcgc tcgaatgagc ttgctgtgcg acggtggctt gcaagttatt
     401  gcaaggaaag gaggttggtt gacacacacg ctctacaagc gatcgctttg
     451  gccactcctc tggtacttac gccaggggcc gctgaaatca ctgaaagagc
     501  gatccttaat agtgctgtct tcggtatgcg gagagcggct cttgctgaag
     551  cctctaagcc gactagtctc ggataccaga tggtgtttga gccacatcgg
     601  ccgaggactt ggcttagggc ctggcggaaa gtggtgggtc tccctgattt
     651  tcaggggtac tcgcccgtga aataggggtg ccttagggaa atagctggtg
     701  tggacaccaa aattgtccgt ggagagcacc agtctatggc cgtattccct
     751  agggaaggaa tctccaaacc ccggcgcatc ttccaagtct gtggaatggg
     801  taatgggacc actttcggag ttcacaacaa ttccttgact aacttaagga
     851  gaggtcttgt tgagagagtg ttctacgttg aagatgcctg caaaaatcta
     901  gtcccaaccc ctcggcccct acctggaaaa ttccaggagc tgaagtatct
     951  ggctcgacgt gtcgctcgta ttgctggaca tcatacccct atccccaggg
    1001  agcaatatcc tgggttgtat aagggcagga ggtaccaaat ttacgccgat
    1051  gcggtcaaca gtttggcgtc gaacccggtt caccggcgag actcctttct
    1101  gaagacattc gtgaaagcag agaagatcaa cttctctgcg aaaccagacc
    1151  ctgctcctag agttattcag ccaagggatc cgagatataa tgtagaggta
    1201  ggtagatatc ttaaacccta cgaacaccat ctatatagag ctctagatgt
    1251  tgtttggaag ggtcctactg tgctaaaggg atatactgta agtgagattg
    1301  gaagtattat gcattcacac tggtcacaat tccagaaacc atgtgctgtg
    1351  ggttttgata tgaaacgatt tgatcagcac gtttctgtgg atgcgctgcg
    1401  atttgagcac tctgtgtacg gaaggagttt ttgctctaag gagcttgaca
    1451  gattgctcga gtggcagctc ctcaattccg gggtaggcca tgcgaacgac
    1501  gggtacatta ggtacaaggt tgatggatgt aggatgagtg gggacgtgaa
    1551  cactgctatg ggaaactgtc tcctcgcttg tctcatcacc aagcacctcc
    1601  ttaagggcat cagatgcaga ctcattaaca atggcgatga ctgcgtcctc
    1651  ttctttaaca ctccagatct agctgcggtc actgaaaggt tggctcactg
    1701  gcttgatttt gggtttcagt gtgttgttga ggaaccagtc tatgagcttg
    1751  aagaggttga gttctgtcaa atgaagccgg tgtttgatgg tgaggagtgg
    1801  gtatgtgtgc ggaacgttca cgtgtcggta gcgaaggata cctactccat
    1851  caatccttgg aataatgaga atgatgcggg caggtggata cgggctattg
    1901  gggaatgcgg tgaggcactc accgggggca tcccggtgct gaatgcatat
    1951  tacaaggtgt tcaaacgagc atataaagca ccaggtaagg tgaaagagag
    2001  tttagctttc gattctggta tgtatcgact ctcccaacgg tgttctagga
    2051  gctttcacga accaacagag gaagctaggg tgagcttctt caaggctttt
    2101  ggggtggacc cgatggcgca gatggccata gaggagtttt atgactccct
    2151  ggacattgag cttgagttcg ccccggaggg aaaacttgat gatatctctc
    2201  tcttatggct tctacgcaaa cgaatgatag cttcatagaa ctaaatcctc
    2251  acgacactgg tcacaacaag ggcgcaggta agggaaacag gcaagctaag
    2301  aaggaggttg cactccaggc agtgcacaaa gccaataaac aagatgaagc
    2351  tatttctggg ggttcttttg tttttgttgc tgataaagtt gaggttacca
    2401  ttaacatcaa cttttgacat cgacttaagg accctccggg aaaactgctt
    2451  cattatcgct acgcttagct tatttgggtt ctttatcact gtcctgatta
    2501  aggctgaatc agaacaccat cacttccact cacacgacag tagtaagaca
    2551  cagaacatag tagttaatac tggaaagtaa cccaccatgg tgcagaagaa
    2601  tgtcccagcc gttcaaagtg cgtttaaagc ccattttccc tgggcaatca
    2651  aaattaagac ggatgggtgg gctgttcttt ttaagggtca aaagggggca
    2701  gccaatagat acgcgggtgg aacccgtcct gttacttctc aaattaagct
    2751  gtcaacactt aaggttacag ctccggtggc cgcctcgatg cggactcgta
    2801  accctggagc aaacattagg acggctggaa aatcggtcac tgtcgtccat
    2851  tgcgagtttg tgggcaatat cgcccggcag actggtagtg ggctactggt
    2901  ggtcgagaga acgattaacc ccagcaacgt actcagcttc ccctggcttt
    2951  ctgtacttgc tgccggatat gagaagtacc gcgtgtcatc actatctctt
    3001  cgatattctc caacttgcgc cactacgacg gagggcaagg tcatcttggc
    3051  atttgataaa gatgctgcag atgcttcccc tacctccaag agcgacatgt
    3101  ataaccatga tggagcagtt ggagtctcgc cctgggatag tgccatgctg
    3151  caaatacctt gtgataatgt ggataggttt attaatgatt ccagtagttc
    3201  cgaccctaag cttgttgact ttggtaaggt ggttgttgcc aattatggcc
    3251  aatctgaagg ggatgtggat gtgatcggag agctattcct gcaatactcc
    3301  gtcaccctca aaatccccca aggcacagcg acactaacac agtccggggt
    3351  aggcatttca tcagttggtc cctccctctt ccgggttcaa ctcagagatg
    3401  gcacgtatgt gtttacctgc aacggaactg gtcgcttctt gttcttcttc
    3451  aactcaaccg ttgatgcaac ctccaccatc gctggaatgg aggtgaagca
    3501  gaagagttcg accgatgaca aaggagaaac aacgataatg gaactactag
    3551  ctactgaatc aggcggtatg atagcaataa tggtggccac aggcacactc
    3601  acttggtggg cttgtaggaa ttaggtttgt attgtatggg cctccgtgaa
    3651  gttaggggca gtggaaacgt cggtctagcc agccgtcccc tgggtagtgt
    3701  gctctgtcta tgtacaccac tactcggttt ccacaaacga tcggactccc
    3751  aatatagtgt acattatgtt gattgcttct ttctacctat ataatatctc
    3801  ctctcatctc tcctctacgc ttggaatcca taaaatcctt cgggtgggct
    3851  tggatttcgg gtacttgttt gaaattccct cacgaccgcc atagttgtga
    3901  ggcagccc