Sequence of DPV Sweet clover necrotic mosaic virus

Sweet clover necrotic mosaic virus unidentified genes, three complete cds's including fusion protein.

ACC No: L07884

Dated: 2006-04-04 | Length: 3876 | CRC: 1137551825

                
ID   L07884     standard; genomic RNA; VRL; 3876 BP.
XX
AC   L07884;
XX
SV   L07884.1
XX
DT   07-JAN-1994 (Rel. 38, Created)
DT   04-APR-2006 (Rel. 87, Last updated, Version 4)
XX
DE   Sweet clover necrotic mosaic virus unidentified genes, three complete cds's
DE   including fusion protein.
XX
KW   fusion protein.
XX
OS   Sweet clover necrotic mosaic virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Dianthovirus.
XX
RN   [1]
RP   1-3876
RX   DOI; 10.1016/0168-1702(93)90130-F.
RX   PUBMED; 8317142.
RA   Ge Z., Hiruki C., Roy K.L.;
RT   "Nucleotide sequence of sweet clover necrotic mosaic dianthovirus RNA-1";
RL   Virus Res. 28(2):113-124(1993).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .3876
FT                   /organism="Sweet clover necrotic mosaic virus"
FT                   /strain="59"
FT                   /mol_type="genomic RNA"
FT                   /db_xref="taxon:28348"
FT   mRNA            121. .2423
FT                   /product="fusion protein"
FT   CDS             121. .831
FT                   /codon_start=1
FT                   /product="ORF1"
FT                   /db_xref="UniProtKB/TrEMBL:Q87028"
FT                   /protein_id="AAA47455.1"
FT                   /translation="MGFISFSLFDVDKLLVWVSKFNPGKILSSICNLGVDCWNRFRKWF
FT                   FGLNFDAHMWAVDAFMLLMPFYTEQMERVVDDFCSETQESKLEDCLELDPSVNEFFDEE
FT                   VYKRDEEGVMVLQRTSSRKHIKRVRAGMMQAAIKAVEKRITNRHTIFGDDMGKVDEAAV
FT                   RATASDICGEFKINEHHTNVLVYAAAYLAMTPDQRSIDSVKLAYNPKSQARRTLVTAVR
FT                   ENKAVAGFKSLEDF"
FT   CDS             924. .2423
FT                   /codon_start=1
FT                   /product="ORF2"
FT                   /db_xref="GOA:Q87029"
FT                   /db_xref="InterPro:IPR002166"
FT                   /db_xref="InterPro:IPR007094"
FT                   /db_xref="InterPro:IPR007095"
FT                   /db_xref="UniProtKB/TrEMBL:Q87029"
FT                   /protein_id="AAA47456.1"
FT                   /translation="MKSKRVVGLPAVSAGLKVCVHQTSLHNMIVSLERRVFRVKNAAGE
FT                   LVVPPKPIQNAFDSISYFRDAWLRKLSHKGQVLKSSIADVVACYSSEKRKLYQKAADSL
FT                   EKKPVQWRDSKVQAFIKVEKLECDTKDPVPRTIQPRSKRYNLVIGQYLRLNEKKMLDAI
FT                   DDVFGEKTVLSGLDNRAQGRAIAHKWRKYQNPIGIGLDASRFDQHCSVDALKFEHTFYK
FT                   ECFPGDQQLEQLLKWQLTNTGSALLPTGELVRYRTKVGRMSGDINTGLGNKILMCSMVH
FT                   AFLKETGVRASLANNGDDCVLFCEKGDYEQINRNLEQWFLCRGFEMTVEKPVDVLEKVV
FT                   FCRSQPVCIATQWAMVRQLGSLSRDCFSTQDWLNPKTFKDAMNALGQCNGIINDGVPIH
FT                   MAQAKLMHKSAETGSSIWRSLHKQMEYRWRDRLGKRTNLLWSEVEDATRLSYFRAFSIE
FT                   PYVQRIVEEYLSQVEVTCEGRETNVLPTHYSRIHKDLIKSR"
FT   CDS             2424. .3440
FT                   /codon_start=1
FT                   /product="ORF3"
FT                   /db_xref="GOA:Q87030"
FT                   /db_xref="HSSP:2TBV"
FT                   /db_xref="InterPro:IPR000937"
FT                   /db_xref="UniProtKB/TrEMBL:Q87030"
FT                   /protein_id="AAA47457.1"
FT                   /translation="MSTKAPKKSKQRSKPRNRNPSTSVKTVTIPFAKTQIVKTVNPPPK
FT                   PTKAALHTQLVLSVVGSIALRANNGKASQRFRLNPSNPALFPTIAYEAANYDMYRMKKL
FT                   TLRYVPLVTVQNSGRVAMIWDPDSQDSVPQSRQEISAYSRSISTAVYEKCSLTIPADNQ
FT                   WRFVADSNVVDRKLVDYGQLLFVNHSGSEGIETGDVFLECEVEFKGPQPTATVVQRGII
FT                   DRGGVLTGEGPSYLLPTDIVITATGISMNLDVAGTYLVTLVVTSSGSGNLQVLGNSTLV
FT                   GDFRTAYSGINFIATFVLTSTGVPSPTSSILFNESTGVTRAQFSIVRSKPSNAYVFG"
XX
SQ   Sequence 3876 BP; 1065 A; 888 C; 1000 G; 923 T; 0 other;

l07884 Length: 3876  04-APR-2006  Type: N  Check: 9583  ..

       1  taaacgtttc accggtttgt aaattggaac ttcgtagttc gccagacgcc
      51  ttcttcgtat caaggaactg gaaattgtac ggtgagtctg tcattttatt
     101  ttctactttt cgtaccagtc atgggtttta ttagtttttc gctttttgat
     151  gtggataaat tgttggtatg ggtgagcaaa tttaacccag gtaagatact
     201  gtcttccata tgcaacttgg gtgtggactg ttggaaccgc ttccgtaagt
     251  ggttctttgg cctcaacttc gatgcgcata tgtgggccgt ggatgctttt
     301  atgctgctca tgccatttta cacggagcag atggaacgtg tagtcgacga
     351  cttctgcagc gaaacccaag aatccaaatt agaagactgt ttggaattgg
     401  acccctccgt taacgagttc ttcgatgagg aggtgtacaa gagagatgag
     451  gagggcgtga tggttctcca aaggacgagc agccgtaagc acatcaaacg
     501  tgtgcgcgct gggatgatgc aagcggcaat taaggccgta gagaagagaa
     551  tcacaaatcg tcacaccatc tttggtgatg acatgggtaa ggtggatgaa
     601  gctgctgtta gggccaccgc tagcgatatt tgcggtgagt tcaaaatcaa
     651  cgaacaccac accaacgtgt tggtgtatgc cgcagcatac cttgccatga
     701  caccagacca acggtcgatt gacagtgtca agctcgccta caatccaaag
     751  agtcaagcca ggcgaacttt ggtcacagcc gttcgtgaga acaaggctgt
     801  tgccgggttc aaatcccttg aggattttta ggcggtccac tcagctttcc
     851  ggtcgaagat gccccatacc ctatcctagg catcccggaa atcagggtag
     901  ctgagaagcg ggccagtaga gtcatgaaaa gtaagagagt cgtagggtta
     951  cctgctgtta gtgcgggtct taaggtttgc gtccatcaaa cctccctaca
    1001  taatatgata gttagtctcg aacgtagggt cttccgagtg aagaacgctg
    1051  cgggagagtt agtagtacct cccaaaccaa tccaaaatgc atttgactct
    1101  atttcctatt tccgcgatgc gtggttaagg aaactgtctc acaagggtca
    1151  agtgctaaaa tcctccatag ctgacgtcgt cgcatgctac tcctctgaaa
    1201  agaggaaact atatcaaaag gcggctgact ctttggagaa gaaacccgta
    1251  caatggaggg attccaaggt gcaagcattc atcaaagtag aaaaacttga
    1301  atgtgacact aaagatcccg tgcctcgcac gattcagcct cggtccaaaa
    1351  ggtacaacct agtgatagga caatacctca gactgaatga gaagaagatg
    1401  ctggacgcca tagacgacgt ctttggagag aagacagttc tgtcgggttt
    1451  ggataacagg gcccaaggga gggccatcgc ccacaagtgg cgtaaatacc
    1501  agaaccccat cgggatcggc ttagatgcat cgagattcga tcagcattgt
    1551  agcgtggatg ccctcaaatt cgagcacacc ttctacaagg agtgttttcc
    1601  tggggatcaa cagttggagc aattattgaa atggcagtta accaatacag
    1651  ggtctgcatt attgccaact ggagaactgg tcagataccg caccaaagtg
    1701  ggtcgcatga gcggcgacat aaacacaggc cttgggaaca agattctcat
    1751  gtgcagcatg gtgcacgcat tcctgaagga gacgggtgtg cgggcttcgt
    1801  tagccaataa cggcgacgac tgtgtccttt tctgtgagaa gggagattat
    1851  gagcagataa accgcaatct tgagcaatgg ttcctgtgca ggggtttcga
    1901  aatgaccgtc gagaaacctg tcgatgtact cgagaaggtg gtgttctgtc
    1951  gtagtcaacc ggtttgcatt gccacgcaat gggctatggt aaggcaattg
    2001  gggagtttgt caagagactg cttctcaacg caggattggt tgaacccaaa
    2051  gacatttaaa gatgcaatga acgcgcttgg acaatgcaat ggaatcatca
    2101  atgatggtgt gcccatacac atggctcagg ctaaattgat gcataaatcg
    2151  gcggaaaccg gaagttcaat ctggaggtca ctccacaagc aaatggagta
    2201  ccgctggaga gatcgtctcg gtaaaagaac aaatctattg tggagtgagg
    2251  ttgaggatgc cacgagactg tcatacttta gagcattcag tatagaacct
    2301  tacgtacaga ggatagtgga ggagtacctc tctcaagtcg aagtaacttg
    2351  tgaggggcga gaaacaaacg tattacctac acactattct agaatccaca
    2401  aagatctaat caaatcccga taaatgtcta caaaagctcc caagaaatcc
    2451  aaacaacggt ccaagcccag gaaccggaac ccaagtacta gtgtcaagac
    2501  ggtgaccata cctttcgcga agacgcaaat cgtaaagacc gtgaaccctc
    2551  cacccaagcc aacaaaggct gcgttacaca cccagttggt gttgagtgta
    2601  gtaggttcca ttgcgttgcg cgccaataat ggcaaggcca gtcaaaggtt
    2651  taggttaaac ccgagtaacc cggcactatt tcccaccata gcatacgaag
    2701  ccgcaaatta tgacatgtac cgaatgaaga aactgacact ccgctacgtc
    2751  cccctcgtaa ccgtgcaaaa ttccgggcga gtggcaatga tatgggatcc
    2801  cgactctcaa gactcggttc cccagtcgcg acaggagata tcagcctatt
    2851  ctcggtcaat ctcgactgcc gtgtacgaga aatgctcgtt gacgattccg
    2901  gcggataatc aatggcgctt cgttgcagac agcaatgttg ttgacaggaa
    2951  actggtcgat tacggccaat tgttgttcgt caaccattct gggagtgagg
    3001  gaatagaaac cggagatgtg ttcctcgaat gtgaagtcga gtttaagggc
    3051  ccccagccta ccgccacagt ggtccagaga gggatcatag atcgcggagg
    3101  ggtgctcacc ggcgaaggac catcttactt gctacctact gacattgtca
    3151  tcaccgcgac ggggatatca atgaacctgg atgtcgctgg aacttatctc
    3201  gtcaccttgg tagtgacttc ttctggcagt ggcaacctcc aagtgttggg
    3251  gaattcaacc ttggtcggtg actttagaac ggcgtatagt gggattaact
    3301  ttatagctac gtttgtgctc accagcactg gcgttccatc acccacatct
    3351  agtatactgt tcaatgagtc aaccggggtc acccgcgcac agttcagcat
    3401  cgtgagatcg aagccgtcga acgcctatgt atttggttaa tgcaagcgta
    3451  acctccatcc gagttgcaag agagggaaac gcagtctcgc cgaccctgtt
    3501  gccaaacagt aaaattggaa aaaatagagt gttaggagta gttcccgtac
    3551  ccgcgggaca agaacctatt gtagtagacg aaccggtctc ggaccctggt
    3601  aaacaggtac ctagcgtaat agaaggtcgc tagaaatcgg gtgggcttca
    3651  cctacgggta acccaccgtc gagagggaaa acctctgtgt ggttgtgcgc
    3701  acgtcgtttc ctgaagaatc tcactgcagt agttatttcc ttttcctttt
    3751  aggctagaag cacttgctac ggagggcgca taccttcggt taaacaaaat
    3801  tggcccctga gagtagaaaa ctcaggttaa taaaacagga gattatttgc
    3851  ttagtcgtat aacggctaag cacccc