Sequence of DPV Citrus tristeza virus

Citrus tristeza virus coat protein mRNA, complete cds.

ACC No: L12175

Dated: 2004-09-09 | Length: 672 | CRC: 1923364045

                !!NA_SEQUENCE 1.0
ID   CTVCOATB   standard; mRNA; VRL; 672 BP.
XX
AC   L12175;
XX
SV   L12175.1
XX
DT   10-MAR-1993 (Rel. 35, Created)
DT   09-SEP-2004 (Rel. 81, Last updated, Version 5)
XX
DE   Citrus tristeza virus coat protein mRNA, complete cds.
XX
KW   coat protein.
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Pappu H.R.;
RT   "The nucloetide sequence of the coat protein gene of the B35 isolate of
RT   citrus tristeza virus";
RL   Unpublished.
XX
RN   [2]
RP   1-672
RX   MEDLINE; 93234553.
RX   PUBMED; 7682715.
RA   Pappu H.R., Pappu S.S., Manjunath K.L., Lee R.F., Niblett C.L.;
RT   "Molecular characterization of a structural epitope that is largely
RT   conserved among severe isolates of a plant virus";
RL   Proc. Natl. Acad. Sci. U.S.A. 90(8):3641-3644(1993).
XX
RN   [3]
RP   1-672
RA   Pappu H.R.;
RT   ;
RL   Submitted (03-MAR-1993) to the EMBL/GenBank/DDBJ databases.
RL   H.R. Pappu, Plant Pathology, University of Floriday, Gainesville, FL
RL   32611-0680, USA
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /db_xref="taxon:12162"
FT                   /mol_type="mRNA"
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="B35"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /db_xref="GOA:Q06192"
FT                   /db_xref="UniProt/TrEMBL:Q06192"
FT                   /function="encapsidates the viral RNA"
FT                   /product="coat protein"
FT                   /protein_id="AAA03701.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVVAAESSFGSVNLHIDPTLITMNDV
FT                   RQLSTQQNAALNRDLFLALKGKYPNLPDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLSDKLWTDIVYNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 197 A; 121 C; 170 G; 184 T; 0 other;

L12175  Length: 672  September 14, 2004 08:36  Type: N  Check: 3984  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaacaagg aaacgaaaga
      51  aggcgacgat gttgttgctg ctgagtcttc tttcggttcc gtaaacttac
     101  acatcgatcc gactctgata acgatgaacg atgtgcgtca gttgagtact
     151  caacagaatg ctgctttgaa cagggactta tttcttgctc tgaaagggaa
     201  gtatcctaac ttgcctgaca aagataagga ctttcacata gctatgatgt
     251  tataccgttt agcggttaag agttcatcat tgcaaagtga tgatgacacc
     301  acgggcataa cgtacactcg ggagggtgtt gaagtagatt tgtctgacaa
     351  actttggacc gacatcgtgt ataattctaa gggtattggt aaccgaacta
     401  acgcccttcg agtctggggt agaactaacg atgctcttta cttagccttt
     451  tgtagacaga accgcaattt gagttatggc ggacgtccgc tagatgcagg
     501  gattccggct gggtatcatt atttgtgtgc agatttcttg accggagctg
     551  gcttgactga tttagaatgt gctgtgtaca tacaagctaa agaacaattg
     601  ttgaaaaagc gaggggctga tgaggttgta gttactaatg tcaggcagct
     651  tgggaaattt aacacacgtt ga