Sequence of DPV Infectious hematopoietic necrosis virus

Infectious hematopoietic necrosis virus complete genome.

ACC No: L40883

Dated: 2000-03-04 | Length: 11131 | CRC: 484006911

                !!NA_SEQUENCE 1.0
ID   IHNCG      standard; RNA; VRL; 11131 BP.
XX
AC   L40883;
XX
SV   L40883.1
XX
DT   11-APR-1995 (Rel. 43, Created)
DT   04-MAR-2000 (Rel. 63, Last updated, Version 4)
XX
DE   Infectious hematopoietic necrosis virus complete genome.
XX
KW   complete genome; G gene; G protein; glycoprotein; L gene; L protein;
KW   M2 gene; matrix protein; N gene; non-virion protein; nucleocapsid protein;
KW   NV gene; P(M1) gene; polymerase-associated protein; RNA polymerase.
XX
OS   Infectious hematopoietic necrosis virus
OC   Viruses; ssRNA negative-strand viruses; Mononegavirales; Rhabdoviridae;
OC   unclassified Rhabdoviridae.
XX
RN   [1]
RP   1-11131
RX   MEDLINE; 96118173.
RA   Morzunov S.P., Winton J.R., Nichol S.T.;
RT   "The complete genome structure and phylogenetic relationship of infectious
RT   hematopoietic necrosis virus";
RL   Virus Res. 38(2-3):175-192(1995).
XX
DR   SPTREMBL; Q82680; Q82680.
DR   SPTREMBL; Q82681; Q82681.
DR   SPTREMBL; Q82682; Q82682.
DR   SPTREMBL; Q82683; Q82683.
DR   SPTREMBL; Q82684; Q82684.
DR   SPTREMBL; Q82685; Q82685.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .11131
FT                   /db_xref="taxon:11290"
FT                   /note="virus was isolated from chinook salmon embryo cell
FT                   line"
FT                   /organism="Infectious hematopoietic necrosis virus"
FT                   /strain="WRAC"
FT                   /lab_host="Oncorhynchus tschawytscha"
FT   3'UTR           1. .46
FT                   /note="3'-untranslated region of virus genomic RNA coding
FT                   for putative (+)-leader RNA transcript.; putative"
FT                   /standard_name="(+)-leader transcript"
FT                   /function="unknown"
FT   misc_signal     41. .74
FT                   /note="The region at nucleotide position from 41 to 74
FT                   includes putative signal for termination of putative
FT                   (+)-leader RNA transcription, followed by putative N gene
FT                   mRNA transcription initiation signal.; transcription
FT                   termination and transcription initiation; putative"
FT   CDS             175. .1350
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:Q82680"
FT                   /evidence=EXPERIMENTAL
FT                   /gene="N gene"
FT                   /function="genomic RNA encapsidation"
FT                   /product="nucleocapsid protein"
FT                   /protein_id="AAC42150.1"
FT                   /translation="MTSALRETFTGLRDIKGGVLEDPETEYRPSTITLPLFFSKTDLDL
FT                   EMIKRAVSQVGGEGTRKALSLLCAFVIAETVPSEAGTVAELLEALGFVLESLDTGAPPD
FT                   ATFADPNNKLAETIVKENVLEVVTGLLFTCALLTKYDVDKMATYCQNKLERLATSQGIG
FT                   ELVNFNANRGVLAKIGAVLRPGQKLTKAIYGIILINLSDPAIAARAKALCAMRLSGTGM
FT                   TMVGLFNQAAKNLGALPADLLEDLCMKSVVESARRIVRLMRIVAEAPGVAAKYGVMMSR
FT                   MLGEGYFKAYGINENARITCILMNINDRYDDGTSRGLTGIKVSDPFRKLAREIARLLVL
FT                   KYDGDGSTGEGASELIRRAEMASRGPDMGEEEEEDEEDDDSSEPGDSDSFH"
FT   misc_signal     1418. .1444
FT                   /note="This region includes transcription
FT                   termination/polyadenylation signal for N gene, followed by
FT                   putative transcription initiation signal for P(M1) gene.;
FT                   putative"
FT                   /function="transcription termination/polyadenylation and
FT                   initiation"
FT   CDS             1466. .2158
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:Q82681"
FT                   /evidence=EXPERIMENTAL
FT                   /gene="P(M1)"
FT                   /standard_name="P(M1) protein"
FT                   /function="Required for virus transcription/replication"
FT                   /product="polymerase-associated protein"
FT                   /protein_id="AAC42151.1"
FT                   /translation="MSDGEGEQFFNLEGEDILRLESRLKTPRNDGQIGKNPRRRKEDQA
FT                   PQEEPKKTTRRPDKNKGLSQLEQLILKYVEEESCQDALKDFGGLIANIRQAHQAEMTSH
FT                   LEKVATEHRANLQALTKSQQEHEKVSKEILSAVIAIRSNLNENHSPLPKPLDPDQVKAA
FT                   RALGFGIGYRTALNVFDRIKGVTPDNAGSQEVKNLAIRAAEEDEYEGSPTFFRKVIDAV
FT                   KKRMKQGQ"
FT   misc_signal     2187. .2213
FT                   /note="This region includes transcription
FT                   termination/polyadenylation signal for P(M1) gene, followed
FT                   by putative transcription initiation signal for M(M2)
FT                   gene.; putative"
FT                   /standard_name="transcription termination/polyadenylation
FT                   and initiation"
FT   CDS             2255. .2842
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:Q82682"
FT                   /evidence=EXPERIMENTAL
FT                   /gene="M2"
FT                   /standard_name="M2 protein"
FT                   /product="matrix protein"
FT                   /protein_id="AAC42152.1"
FT                   /translation="MSIFKRAKKTVLIPPPHLLSGDEERVTILSAEGEIKVTGRRPTTL
FT                   EEKIYYSMNLAAAIVGGDLHPSFKSMTYLFQKEMEFGSTQEKVNFGSRKPAPQTTYQVT
FT                   KAREVYLQTQPLEKKIPMQTYSVSTEGATITFTGRFLFSSSHVGCDDNRTKLAGLDGFT
FT                   TSNSYQRVKDYYAQETALALTFAAPEKRGKEK"
FT   misc_signal     2933. .2959
FT                   /note="This region includes transcription
FT                   termination/polyadenylation signal for the M gene, followed
FT                   by putative transcription initiation signal for the G
FT                   gene.; putative"
FT                   /standard_name="transcription termination/polyadenilation
FT                   and initiation"
FT   CDS             2999. .4525
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:Q82683"
FT                   /evidence=EXPERIMENTAL
FT                   /gene="G"
FT                   /standard_name="G protein"
FT                   /product="glycoprotein"
FT                   /protein_id="AAC42153.1"
FT                   /translation="MDTMITTPLILILITCGANSQTVKPDTASESDQPTWSNPLFTYPE
FT                   GCTLDKLSKVNASQLRCPRIFDDENRGLIAYPTSIRSLSVGNDLGDIHTQGNHIHKVLY
FT                   RTICSTGFFGGQTIEKALVKMKLSTKEAGAYDTTTAAALYFPAPRCQWYTDNVQNDLIF
FT                   YYTTQKSVLRDPYTRDFLDSDFIGGKCTKSPCQTHWSNVVWMGDAGIPACDSSQEIKAH
FT                   LFVDKISNRVVKATSYGHHPWGLHQACMIEFCGQQWIRTDLGDLISVVYNSGSEILSFP
FT                   KCEDKTVGMRGNLDDFAYLDDLVKASESREECLEAHAEIISTNSVTPYLLSKFRSPHPG
FT                   INDVYAMHKGSIYHGMCMTVAVDEVSKDRTTYRAHRATSFTKWERPFGDEWEGFHGLHG
FT                   NNTTIIPDLEKYVAQYKMSMMEPMSIKSVPHPSILALYNETDVSGISIRKLDSFDLQSL
FT                   HWSFWPTISALGGIPFVLLLAVAACCCWSGRPPTPSVPQSIPMYHLANRS"
FT   misc_signal     4554. .4580
FT                   /note="This region includes transcription
FT                   termination/polyadenylation signal for the G gene, followed
FT                   by putative transcription initiation signal for the NV
FT                   gene.; putative"
FT                   /standard_name="transcription termination/polyadenylation
FT                   and initiation signal"
FT   CDS             4595. .4930
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:Q82684"
FT                   /evidence=EXPERIMENTAL
FT                   /gene="NV"
FT                   /standard_name="NV protein"
FT                   /product="non-virion protein"
FT                   /protein_id="AAC42154.1"
FT                   /translation="MDHRDINTNMEALREALRYKNEVAGHGFSFDDGDLVWREEDDATW
FT                   RRLCDVVNALISSKRMQRVLYMDLSITKGEGHLLLVDLQGTKNRLYKEPRFRRHLILIE
FT                   DFLAYPR"
FT   misc_signal     4925. .4951
FT                   /note="This region includes transcription
FT                   termination/polyadenylation signal for the NV gene,
FT                   followed by putative transcription initiation signal for
FT                   the L gene.; putative"
FT                   /standard_name="transcription termination/polyadenylation
FT                   and initiation signal"
FT   CDS             5016. .10976
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:Q82685"
FT                   /evidence=EXPERIMENTAL
FT                   /gene="L"
FT                   /standard_name="L polymerase"
FT                   /function="transcription/replication"
FT                   /product="RNA polymerase"
FT                   /protein_id="AAC42155.1"
FT                   /translation="MDFFDLDIEIKQERLPAECSLNSPLNYSLSAQLTDRMTPRTENVR
FT                   RQRERLRSHMREHFRVKDLSTLDNDSTRLHARLTEDLITIQSPEIDSSVLENWPPLKSY
FT                   IASLDYTLPEKTAFKWEQAAPYWNLFAQLRAILLQSQKIKKQETGTRELYSCVPLQIEF
FT                   VEGVVLYFTDRGSKEEFTKSGELPSVTPYADFLAWIKIISQRAQAVLMAVILRVTDKGL
FT                   SPLPESLLAIYQNVDDILKRAGQPAIDLLKLWEPLVITKLGELLGDRFGLEEDFRNTIR
FT                   GEATKLAKNLFISRGLNRLMDILDQQTDAQPLFQFFGLFKHFAYPRVFSRDTIQAIQEV
FT                   SDRPSSISAVDFLHDQCEIRKEFYIRYINAYHRAPGLDLSALSPSSFLRDSLERGKIPN
FT                   ERSPLYSNKEWYFVKFTKSIEWPVSDTLSTFLSDKAITRDRPAWIEDGHSGRDMSEKRL
FT                   LLKFIKENFSSVADIVGAAEAIYNKEEDLLIALKVKEMELKIKGRGFGLMTFMPRLLQV
FT                   LRESIAKKTQKLFPEITMTSSDLDMKKRKFMLSKKSDDRRGFIHVNKSLDINKFCTSQR
FT                   QFNSNAVFSSLDELMGTFPLFSRVHEIFEKTWIVDGSSSDPPNLAHFTRILDECTALGL
FT                   DTPHIWADGVFSGLKGGIEGLCQYVWTICLLLRVERVMQKTALTHYILAQGDNVIITII
FT                   VPVEIHRDGTIPEQESRRILSLSREIDLSLESELEKSGLTLKIEETLTSENISIYGKDL
FT                   HCPQHLTLAIKKAASAAIISSEQYQDVPTFLSGLGTSLEALSECVNNKVGVHLFGVIMG
FT                   VAGWRDLATHQTWRGWRYPYHKKAITGRIRASEMKLSKGEPTELSISVLSKRRRERETL
FT                   IELLSNSLLGSALGMLAFPTPLDLEKRGVGDYITHRLTIARKAILSGHLDPRIGRKVES
FT                   ACNIPLSSRTDLSKLFDSPFSLNIATEEDATAVIKRQATKILRLQEIKNEKLRAQIDNM
FT                   DKGIATLDAALAGATNINPRLNYMIRSITDEKESEMFVTKFASARTMRTLAMNHSSELP
FT                   IVTLLEMKSQQKETYTIWRTKRPPVTMWKCSTVLAKELRDTSWGKNIIGGTSPSPIEAM
FT                   ETIQIDPTEWEDRRSQDAMSINYYLSRAGMDEQTAKLTRGFLVPYYGTQTKPLVAKAYL
FT                   ELKGNPRTNKALLLLSVRESLVKTGSNLDKLIIKLCSHALDIDVASLPALRAQEEAAAG
FT                   EGLRGGIKESMSPVGPDNFYTNITHKVFNRKWATPYHVNIADFIIQGLIETRRHLLVNE
FT                   RMNGLLPVSSVKCTSCFREKEREFFDIPEEFTWKNESKTSDPAYTYFTTWCDLPRVSNL
FT                   PEMDQRSATRLLGRGLALNRSSSGEIITKFYSMPMESQRLLHPVELLLGYGEGVIFGYL
FT                   RSQHINHGALFHIGDESLAKKLRRYVLDTKTQHAKQIGYLFQDEDSLHELLGQGLCPYI
FT                   PRSIPLTITELTNACAITTIRATEVILSTKTRIHHMPVQAIDESDVDTSRLAANNMQTI
FT                   LGDPRPMNLVHLDCDLTHNMVAWESEVELDILKSENFHIDGLLVELTARELPIGDTPWK
FT                   QRDWTCSNDPKIIAKGIKTKSLFIHQGVTGAINLIPDLLVVIGGGLGGCAVPYLQEWPD
FT                   TPIIFATLFDERERISEDGDLIVPPELLVRGMAPRMIEREILEAELCDITNEGNRRLLI
FT                   RLVTKNKRGGKVVLIDEIENRGAPESLLQSSLQDLFEKLDKVCKLNSVHTVRESTVEQF
FT                   SQRVNSIKRSRKAVTLHWNRYNRRDQFEALVIVKGEEAKSDYRISTITSAKAFRKIDEQ
FT                   LEIDGRLSSTQWSLPALPSREKNILFGYVSSVFLKMNLALSANDMDRERLIETIEGTAP
FT                   GLISWKEKLEHRDHAHRSDIEEKGITQDKIFNLICLSWVLKGLRYGVWDTDAQSIVAQT
FT                   VYITRGPKLCPLGEKPKRIFASFKLQSGKRVEDAKGFLSALLHLEGFFPLGEQ"
FT   misc_signal     11018. .11030
FT                   /note="This region contains transcription
FT                   termination/polyadenylation signal for the L gene.;
FT                   putative"
FT                   /standard_name="transcription termination/polyadenylation
FT                   signal"
FT   misc_feature    11031. .11131
FT                   /note="Trailer region of the IHNV genome; putative"
FT                   /standard_name="Trailer RNA"
XX
SQ   Sequence 11131 BP; 3233 A; 3048 C; 2675 G; 2175 T; 0 other;

L40883  Length: 11131  December 21, 2001 15:47  Type: N  Check: 500  ..

       1  gtataagaaa agtaacttga ctaagctcag aaggacacaa ggacagaaaa
      51  aagaaaaagg tggcacttca gttgtaacct gataacgtgc tttagacact
     101  ataaaccgag acagaacaag cagaactatt ttcactgaaa accacacctg
     151  agagacagaa acggatcacg aacgatgaca agcgcactca gagagacgtt
     201  cactggactc agagacatca aggggggagt cctcgaggat ccagagacgg
     251  agtatcgtcc cagtacgata accctccctc tatttttctc caagacagac
     301  ttagacctag agatgatcaa gcgggcggtg agtcaagtcg gaggagaggg
     351  aacgagaaag gcattgagcc tcctgtgcgc gttcgtcatt gcagagacgg
     401  tcccatcgga ggcaggtacg gtcgccgaac ttctggaagc cctgggtttc
     451  gtgctggagt ctttggacac tggggcacca ccagacgcta ccttcgcaga
     501  tcccaacaac aagcttgcag aaacgatcgt aaaggaaaat gtccttgagg
     551  ttgtgaccgg cctcctcttc acctgcgccc tactgactaa gtatgatgtg
     601  gacaagatgg ccacatactg ccaaaacaag ctcgagcgtc ttgcaaccag
     651  ccaagggatt ggcgagttgg ttaacttcaa cgccaacagg ggagtcctgg
     701  ccaagatcgg ggcggtgctt agacccggac agaagctcac caaggctatc
     751  tatgggatca ttctcatcaa cctgtccgac ccagccatcg ctgccagagc
     801  caaggcactg tgcgccatga gactgagcgg gacaggaatg acaatggtgg
     851  ggctgttcaa ccaagccgca aagaacctgg gcgcccttcc agccgacctt
     901  ttagaggatc tgtgcatgaa gtcagtggtg gagtccgcca gacgcattgt
     951  cagactgatg aggatcgtag cagaggcccc aggggtagca gcaaagtacg
    1001  gtgtcatgat gagcaggatg ctcggggagg ggtacttcaa ggcctacggg
    1051  atcaacgaga acgccaggat cacctgcatt ctcatgaaca tcaacgatag
    1101  gtatgacgat gggacctcga gaggactgac agggataaag gtctccgacc
    1151  ctttcaggaa gctggcgagg gagatcgctc gtctccttgt cctcaagtac
    1201  gatggcgatg gctcaaccgg agagggggcg tcagagctga tccgccgggc
    1251  ggagatggca tctcggggac cagacatggg tgaggaggag gaggaggacg
    1301  aggaggacga cgactccagt gagccaggag actccgactc attccactga
    1351  acacaaacag ccccccctct catcccgccc ctcgacccat ccagatgttc
    1401  actccactct gactcctaga tagaaaaaaa tggcactata gtgcttttca
    1451  actcaaacca caacaatgtc agatggagaa ggagaacagt tcttcaacct
    1501  agaaggcgaa gacatactga ggctagaatc ccgtctgaaa accccacgaa
    1551  atgacgggca aatcggcaag aaccccaggc gacggaagga ggaccaggcg
    1601  cctcaagagg aaccaaagaa aaccaccagg aggcccgaca agaacaaggg
    1651  tctatctcaa ctggagcaac tcatcctaaa gtacgttgag gaggagagct
    1701  gtcaggatgc cctgaaggac ttcggaggtc taattgccaa catcagacag
    1751  gcccaccagg ccgaaatgac atctcaccta gaaaaggttg ctacggaaca
    1801  ccgagccaat cttcaggctc ttacaaagtc ccagcaagag cacgagaaag
    1851  tctcgaagga gattttgtct gcggtaattg ctattcggtc caacctcaac
    1901  gagaaccaca gtcccctacc caagccactc gacccggatc aggtgaaggc
    1951  cgctcgtgcc cttggattcg gaattgggta tcgaacggcc ctcaatgtct
    2001  tcgaccgaat caagggagtc accccagaca acgcaggatc ccaagaggtg
    2051  aagaacttgg ccattcgggc ggcggaagag gatgaatacg agggaagtcc
    2101  cactttcttc aggaaggtga tagacgccgt aaagaagcgc atgaagcaag
    2151  gtcaataggc atcctcctcc aggatcccgg ctaccaagac agaaaaaaat
    2201  ggcacgcaag tgtatcgttc caaacgaaat ccaagagtca gtccaaacga
    2251  gagcatgtct attttcaaga gagcaaagaa aacagttctg atccctcctc
    2301  ctcacctcct cagcggagac gaggagaggg tgacaatact cagtgcagag
    2351  ggggagatca aggtgactgg aagaagacca accacacttg aggagaagat
    2401  ctattactct atgaatctgg cggctgccat cgtaggggga gatctacacc
    2451  cttcattcaa atccatgacc tatctgttcc agaaagagat ggagttcgga
    2501  agcacccaag aaaaggtcaa cttcggctct cggaaaccag cacctcagac
    2551  cacctaccag gtaacgaagg cgagggaagt ctaccttcag acccagcctc
    2601  tcgagaagaa gatcccaatg cagacctact cagtcagcac agagggagct
    2651  accatcacct tcacaggacg gttcctgttt tcatccagcc atgtaggttg
    2701  cgacgacaac aggaccaaac tggcggggct tgatgggttc acaacctcca
    2751  acagctacca gagggtcaaa gactactatg cccaggagac agccctggcc
    2801  ctgaccttcg ccgctcccga aaagcggggg aaggaaaaat aggagtcgac
    2851  caggccgtct ctcactcacc catccatcgg ccgacccaac cctcctccat
    2901  ccccagagtc catccactcc tcattccgtc caagacagaa aaaaatggca
    2951  cttttgtgct ttgagacaga acgcaactcg cagagaccca ctaaaacaat
    3001  ggacaccatg atcaccactc cgctcattct cattctgatc acctgcggag
    3051  caaacagcca aaccgtcaaa cccgacaccg caagcgaatc agaccaaccc
    3101  acctggtcaa acccgctctt cacctatccc gagggatgca ctctggacaa
    3151  gctctctaag gtcaatgcct ctcaactgag atgcccaagg atcttcgacg
    3201  atgagaacag ggggctaatt gcctatccca catccatccg gtccctgtca
    3251  gtcggaaacg acctcgggga cattcacacc caagggaacc acatccacaa
    3301  agtcctgtac cgcacaatct gctcaacagg gttcttcggg ggtcagacga
    3351  tagagaaggc gcttgtaaaa atgaaactct ctacgaaaga agcaggggcg
    3401  tatgacacca caaccgcagc cgctctgtac ttcccagctc cccgatgcca
    3451  atggtacacc gacaacgtac aaaacgatct catcttctac tacacaacac
    3501  aaaagagtgt tcttagagat ccctacacca gagactttct ggactcagat
    3551  tttattggag gaaaatgtac caaatcaccc tgccagactc attggtccaa
    3601  cgtagtttgg atgggtgatg cagggatacc agcctgtgat tccagccaag
    3651  agataaaagc tcacctcttt gttgataaaa tctccaatcg agtcgtgaag
    3701  gcaacgagct acggacacca cccctgggga ctgcatcagg cctgtatgat
    3751  tgaattctgt gggcaacagt ggatacggac agatctcggt gacctaatat
    3801  ctgtcgtata caattctgga tcagaaatcc tctcgttccc gaagtgtgaa
    3851  gacaagaccg tgggaatgag gggaaacttg gatgactttg cctatctaga
    3901  cgatctggtg aaggcctctg agagcagaga ggaatgtctt gaggcgcacg
    3951  ccgagataat atcaacaaac agtgtgactc catacctcct atccaaattc
    4001  cgatctccac atcccggaat aaatgacgtc tacgctatgc acaaaggctc
    4051  catctatcac gggatgtgca tgacggtcgc tgtggacgag gtatccaagg
    4101  acaggacaac gtacagggcc catcgcgcta ccagcttcac gaaatgggaa
    4151  cgaccctttg gggatgagtg ggagggcttt cacggattgc acggaaacaa
    4201  caccaccatt attccagacc tggagaaata cgtcgcccag tacaagatga
    4251  gcatgatgga accgatgagc atcaaatccg taccccatcc aagcatcctg
    4301  gccctctaca atgagacaga cgtgtcaggg atctccatca ggaaactgga
    4351  ctcattcgac cttcaatcac tccactggag tttctggccc acaatctccg
    4401  cactgggtgg aattcccttt gttctcctcc ttgctgttgc cgcgtgctgc
    4451  tgctggtcag ggagacctcc cactccctcc gtgccgcaga gtatccccat
    4501  gtatcacctg gcaaaccggt cctaaaggac tcaatcttca cttcctcccc
    4551  accagacaga aaaaaacggc acatttgtgc tgcaaaaaga gacaatggac
    4601  caccgcgaca taaacacgaa catggaggca ctcagagaag ctctgcgata
    4651  caagaacgag gtggccggac acggcttctc ttttgatgac ggagacctgg
    4701  tatggcgtga agaggacgac gcaacgtgga ggaggctttg cgatgtcgtc
    4751  aacgcactga tttcctccaa gaggatgcag cgagtattgt acatggacct
    4801  cagcatcacc aagggcgagg ggcatctact tcttgtggat ctccagggga
    4851  ccaagaaccg cctgtacaaa gaaccccgat tcaggagaca tctgatcctg
    4901  attgaagact ttcttgctta tcccagatag aaaaaaatgg cacttttgtg
    4951  caaaaaaact caagcgcgac tcacagagaa tacaaccagc aacgacagca
    5001  ccccatcaca gaaagatgga cttcttcgat cttgacatag aaataaaaca
    5051  agagagactc ccagcggaat gctccctcaa ctcaccccta aattactcac
    5101  tgtctgcaca actgacagac cgcatgaccc ccagaactga gaacgtcagg
    5151  aggcaaagag aaaggctcag gtcccacatg cgagaacact tccgggtcaa
    5201  ggatctatcc accctcgaca atgactccac caggctccat gcacgactca
    5251  cagaggatct catcaccatt caaagccccg agatcgattc ctcagtcctt
    5301  gagaattggc ccccactcaa gtcctacata gcatctctag actacacact
    5351  cccggaaaag acagccttca agtgggaaca agcagccccc tactggaatc
    5401  tatttgcaca actgagggca attctcctcc agagccaaaa gatcaagaaa
    5451  caagagacgg gcacgaggga actctactct tgtgtccctc ttcagataga
    5501  gttcgtggag ggggtagtct tgtacttcac agatcgagga tcgaaagagg
    5551  aattcaccaa gtcaggagag ctcccaagtg taacaccgta tgcggacttc
    5601  cttgcctgga tcaagatcat ctcccaacgg gcccaggccg tgttgatggc
    5651  agtcatcctc agagtgaccg acaagggact atctccactg ccagaatcac
    5701  tactggccat atatcagaat gtggacgaca tcctgaaacg agcgggccag
    5751  cctgcgatag acctcctgaa actctgggag ccattggtga ttacaaaatt
    5801  gggagaactt ctcggagaca gattcggact agaagaagat ttccgaaaca
    5851  caatacgagg tgaggcaaca aaattggcaa agaacctatt catttcacgc
    5901  gggctcaatc gccttatgga catcctagac cagcaaactg acgctcaacc
    5951  gctctttcaa tttttcggac tattcaaaca ttttgcgtac ccacgtgtct
    6001  tctcaagaga caccatccag gcaatccagg aggtaagcga caggcctagc
    6051  tcaatctcag ctgtcgactt tctccatgat cagtgcgaga ttcgcaagga
    6101  attctacatc agatacataa acgcatacca cagggcacct ggccttgacc
    6151  tctccgccct gagtccctcc tcatttctaa gagacagtct cgagcgtgga
    6201  aaaatcccaa acgaaagaag ccctctctat tcaaacaaag agtggtactt
    6251  cgtcaaattc acaaaaagca tcgagtggcc agttagcgac actctgtcga
    6301  cattcctatc ggacaaagcg atcactcgtg accgacccgc ctggattgag
    6351  gacgggcact cgggtagaga catgtccgag aagcggctgc tactcaaatt
    6401  tatcaaggag aacttctcga gtgttgcaga cattgtcggt gcggcggaag
    6451  cgatttacaa caaagaagag gacctactga tcgcactgaa agtgaaagag
    6501  atggaactaa agatcaaggg caggggattc gggctgatga ccttcatgcc
    6551  tcgtctcctc caagtcctcc gtgagagcat cgccaaaaaa acacaaaaac
    6601  tattccctga gatcaccatg acctcctcag atctggacat gaagaaaaga
    6651  aagttcatgc tctcaaaaaa gagcgacgac aggcgaggct tcatacacgt
    6701  gaacaaaagt ctggacatca acaaattttg caccagccag agacaattca
    6751  actccaatgc ggttttctca agtctagatg aactcatggg gacctttcct
    6801  ttgttttcca gagttcacga aatttttgaa aaaacctgga tcgtagacgg
    6851  gtcatcctcg gatcccccca acttggcaca cttcactaga attctcgatg
    6901  aatgcacggc acttggtcta gacacccctc acatctgggc ggacggggtc
    6951  ttctcggggt tgaagggagg gatcgagggg ctctgtcaat acgtttggac
    7001  tatctgtctt ttacttagag tagagcgcgt catgcaaaaa acagcgctca
    7051  cccactacat tctggcacag ggcgacaatg tgattatcac aattatcgta
    7101  ccagtggaaa tacatcggga tggtaccatt ccagaacaag agtcccgtcg
    7151  tatcttgtcc ttaagtcgag aaatcgatct ctcactggag agtgaactag
    7201  aaaaaagtgg tctcacccta aagatcgaag agactctaac aagtgagaac
    7251  atctccattt acgggaagga tcttcactgt ccgcaacacc tcaccctggc
    7301  aatcaagaag gccgcctccg ccgcgatcat atcaagtgag cagtaccaag
    7351  atgtcccaac atttctatct ggtctcggaa cgagtttgga ggccctctca
    7401  gagtgtgtca acaacaaagt cggggtgcat ctctttggag tgatcatggg
    7451  cgttgcggga tggagggacc tggcgactca tcagacctgg cgaggatgga
    7501  gataccccta tcacaagaag gcgataactg ggcggattcg ggcgtcagag
    7551  atgaagctca gcaaaggcga acccaccgag ctgtccatct ccgtcctctc
    7601  caagcgacgt agagagaggg aaacactcat tgaactacta tccaacagcc
    7651  tgctcgggtc agccctagga atgcttgcgt tccctactcc tctagacttg
    7701  gaaaaacgag gtgtgggaga ctacatcacc catcggctca ccatagcacg
    7751  caaggccatt ctgagtggac accttgatcc ccgtatcggg agaaaagttg
    7801  aatcagcatg caacatcccc ctctcgtcca gaaccgacct aagcaaactg
    7851  tttgactctc cattttcatt gaacatcgca accgaagagg acgcgacggc
    7901  agtcatcaaa cgacaggcaa caaaaatcct ccgactgcaa gagataaaaa
    7951  acgagaagct gagggcccag attgacaaca tggacaaggg catagcgacc
    8001  cttgatgcag cacttgcagg agccaccaac atcaacccca gactgaatta
    8051  catgatcagg agcatcactg acgaaaaaga gtccgagatg ttcgtcacta
    8101  aattcgcatc agcaagaacc atgaggaccc tggcaatgaa tcactcctca
    8151  gaacttccca ttgtcaccct cctggagatg aaaagccaac aaaaagagac
    8201  atacacaatc tggagaacca agagaccacc tgtgaccatg tggaaatgct
    8251  ccacagtgtt ggcgaaggag ctccgagaca cctcctgggg caaaaacata
    8301  atcggaggca catccccttc tccaatcgag gcaatggaga caatccaaat
    8351  cgaccccacc gaatgggaag accgacggtc ccaggacgcc atgtccatca
    8401  actactatct gtcacgggct ggcatggacg aacagacagc aaagctcact
    8451  cgagggttcc tagtccctta ctacgggacc caaacaaaac cccttgtggc
    8501  aaaggcctac ctagaactca agggcaaccc ccgaaccaac aaggctctcc
    8551  ttctcctgag tgttcgagag tctctcgtaa aaacaggcag caatctcgac
    8601  aagttgatca taaagctctg ctcccatgca ctagacatcg atgtagcatc
    8651  actccccgcc cttcgagcac aggaagaggc ggcagctggg gagggtctcc
    8701  gaggaggaat caaagaatcc atgtctccag taggtcccga taacttctac
    8751  acaaacatca cgcacaaggt cttcaacagg aagtgggcaa caccatacca
    8801  cgtcaacatt gcagacttca tcatccaagg cctgatagag accagaaggc
    8851  acctccttgt aaatgagagg atgaatgggc tactcccggt cagttcagtc
    8901  aaatgcactt cctgcttcag ggagaaagag agggagttct ttgatattcc
    8951  cgaggaattc acctggaaaa atgagtcaaa aacctcagat cccgcctaca
    9001  cctacttcac cacctggtgt gacctcccca gggtctccaa cctgcccgag
    9051  atggatcaac ggtcagccac tcgtctcttg ggaagaggac tcgcattaaa
    9101  cagatcctcc tccggtgaaa tcatcaccaa attctactca atgcccatgg
    9151  aatcacaacg gctccttcac cccgtggaac tgctcctggg atatggcgaa
    9201  ggggtcatat ttggatattt gaggagtcag cacataaatc acggagccct
    9251  ctttcacatt ggcgacgagt cactggcaaa gaaactcaga cgttatgtcc
    9301  tagacacaaa gacacaacat gccaagcaaa ttggctacct cttccaggat
    9351  gaggactcat tacatgagct cctgggccaa ggactttgtc catatatacc
    9401  caggtcaatc cctcttacca tcactgaact aacaaacgcc tgcgcgatca
    9451  caaccatcag ggcaacggag gtaatcctaa gcacaaaaac caggatccac
    9501  cacatgcccg tccaggcaat cgacgaatca gatgtcgaca ccagcagact
    9551  agctgcgaac aacatgcaga ccatactcgg agaccccaga cccatgaacc
    9601  tcgtgcatct tgactgcgat ctcacccaca acatggtcgc atgggagtca
    9651  gaagtggaac tcgacatctt gaaatcagaa aacttccaca ttgacggact
    9701  cctggtagaa ctcactgccc gcgagctccc cattggagac accccctgga
    9751  agcaaagaga ctggacctgt tccaacgatc ccaagatcat cgccaagggc
    9801  atcaagacaa aatccctgtt cattcatcag ggcgtgacgg gagcaatcaa
    9851  cttgattccc gatcttctgg ttgtgatcgg gggaggtctc ggagggtgcg
    9901  ccgttcccta ccttcaggaa tggccagaca caccaatcat ctttgcaacc
    9951  ctattcgacg aacgggagag gatctccgag gatggagacc tgattgttcc
   10001  cccagagctc ctggtgaggg gcatggcacc taggatgatc gagagagaga
   10051  tattagaagc agagctgtgt gatatcacca atgaggggaa tcgtcgcctg
   10101  ctaattcgac tggtcacgaa aaacaagaga ggaggcaagg tggtgctcat
   10151  agacgagatc gagaatcgag gggccccaga atcccttcta cagagctcgc
   10201  tccaagacct cttcgagaaa ctggacaaag tctgcaaact caactctgtg
   10251  cacacagtca gagagtcgac agtggaacaa ttctcccaga gggtaaattc
   10301  tatcaaacgc agcaggaagg cagtaacact gcattggaac cgctacaaca
   10351  gaagagacca atttgaggcc ctggtcatcg tgaagggcga agaggccaag
   10401  tccgactacc ggatctccac gattacctcg gcaaaggcat ttcgcaagat
   10451  cgacgaacag ctcgagatag acgggagact ctcgtcgaca cagtggtccc
   10501  tccccgcgct tccttctcga gaaaaaaaca ttctttttgg gtacgtgtca
   10551  tccgtcttcc tgaagatgaa ccttgcactc tcagccaacg acatggaccg
   10601  agagcgactg atcgagacca ttgagggaac cgccccaggg ttgatctcct
   10651  ggaaggaaaa actcgaacac agggaccatg cacatcgctc cgacattgaa
   10701  gagaaaggaa taactcagga caagatcttc aacctcatct gcctctcctg
   10751  ggtcctcaag ggtctgagat acggagtgtg ggacaccgac gctcaatcca
   10801  ttgtagctca aacggtgtac atcactcgag ggccaaagct ctgtccattg
   10851  ggggagaagc ccaagcgcat cttcgcatca ttcaaactac aaagcggaaa
   10901  gcgagttgaa gatgccaagg gattcctgag cgcactgctt caccttgagg
   10951  gcttctttcc actaggcgaa caataggtac actccagcag cacctgagtg
   11001  ccagggacca aacccctaga tacaaaaaaa tggctcccga ctcccatggt
   11051  aagggaacca gtcattgttc tccgttatta aaaacctttt ttaactgcct
   11101  tttgagaacc cttctgttac tttttttata c