Sequence of DPV Cucumber mosaic virus satellite RNA

Cucumber mosaic virus CARNA 5 gene with ORFs I, IIA, and IIB, 5' end, clone Sq10.

ACC No: M20352

Dated: 2000-03-04 | Length: 335 | CRC: 1339495527

                !!NA_SEQUENCE 1.0
ID   CUMCVC01   standard; RNA; VRL; 335 BP.
XX
AC   M20352;
XX
SV   M20352.1
XX
DT   20-FEB-1989 (Rel. 18, Created)
DT   04-MAR-2000 (Rel. 63, Last updated, Version 2)
XX
DE   Cucumber mosaic virus CARNA 5 gene with ORFs I, IIA, and IIB, 5' end, clone
DE   Sq10.
XX
KW   .
XX
OS   cucumber mosaic virus (cucumber mosaic cucumovirus)
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Bromoviridae;
OC   Cucumovirus.
XX
RN   [1]
RP   1-335
RX   MEDLINE; 88179532.
RA   Kaper J.M., Tousignant M.E., Steen M.T.;
RT   "Cucumber mosaic virus-associated RNA 5: XI. Comparison of 14 CARNA 5
RT   variants relates ability to induce tomato necrosis to a conserved
RT   nucleotide sequence";
RL   Virology 163:284-292(1988).
XX
DR   SPTREMBL; Q89492; Q89492.
DR   SPTREMBL; Q89599; Q89599.
DR   SPTREMBL; Q89720; Q89720.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .335
FT                   /db_xref="taxon:12305"
FT                   /organism="cucumber mosaic virus"
FT   CDS             11. .94
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:Q89492"
FT                   /note="ORF I"
FT                   /protein_id="AAA46388.1"
FT                   /translation="MENCAEGLYLREDLSLGGVGYLPAKAG"
FT   CDS             98. .169
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:Q89720"
FT                   /note="ORF IIA"
FT                   /protein_id="AAA46389.1"
FT                   /translation="MLPRTGDRWLASYVRYSQYYTLI"
FT   CDS             135. .263
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:Q89599"
FT                   /note="ORF IIB"
FT                   /protein_id="AAA46390.1"
FT                   /translation="MSATLSTTLSFEPPLSLLAEPGTWFADTMDFRKKHSVRWYES"
XX
SQ   Sequence 335 BP; 70 A; 82 C; 94 G; 89 T; 0 other;

 M20352  Length: 335  December 21, 2001 15:54  Type: N  Check: 7740  ..

       1  gttttgtttg atggagaatt gcgcagaggg gttatatctg cgtgaggatc
      51  tgtcactcgg cggtgtggga tacctccctg ctaaggcggg ttgagtgatg
     101  ctccctcgga ctggggaccg ctggcttgcg agctatgtcc gctactctca
     151  gtactacact ctcatttgag cccccgctca gtttgctagc agaacccggc
     201  acatggttcg ccgataccat ggattttcga aagaaacact ctgttaggtg
     251  gtatgagtca tgacgcacac agggagaggc taaggcttat gctatgctga
     301  tctccgtgaa tgtctaacat tccattacag gaccc