Sequence of DPV Cucumber mosaic virus satellite RNA
Cucumber mosaic virus CARNA 5 gene with ORFs I, IIA, and IIB, 5' end, clone X12.
ACC No: M20356
Dated: 2000-03-04 | Length: 336 | CRC: 1881888221
!!NA_SEQUENCE 1.0 ID CUMCVC05 standard; RNA; VRL; 336 BP. XX AC M20356; XX SV M20356.1 XX DT 20-FEB-1989 (Rel. 18, Created) DT 04-MAR-2000 (Rel. 63, Last updated, Version 2) XX DE Cucumber mosaic virus CARNA 5 gene with ORFs I, IIA, and IIB, 5' end, clone DE X12. XX KW . XX OS cucumber mosaic virus (cucumber mosaic cucumovirus) OC Viruses; ssRNA positive-strand viruses, no DNA stage; Bromoviridae; OC Cucumovirus. XX RN [1] RP 1-336 RX MEDLINE; 88179532. RA Kaper J.M., Tousignant M.E., Steen M.T.; RT "Cucumber mosaic virus-associated RNA 5: XI. Comparison of 14 CARNA 5 RT variants relates ability to induce tomato necrosis to a conserved RT nucleotide sequence"; RL Virology 163:284-292(1988). XX DR SPTREMBL; Q66265; Q66265. DR SPTREMBL; Q89492; Q89492. DR SPTREMBL; Q89781; Q89781. XX FH Key Location/Qualifiers FH FT source 1. .336 FT /db_xref="taxon:12305" FT /organism="cucumber mosaic virus" FT CDS 11. .94 FT /codon_start=1 FT /db_xref="SPTREMBL:Q89492" FT /note="ORF I" FT /protein_id="AAA46400.1" FT /translation="MENCAEGLYLREDLSLGGVGYLPAKAG" FT CDS 98. .169 FT /codon_start=1 FT /db_xref="SPTREMBL:Q66265" FT /note="ORF IIA" FT /protein_id="AAA46401.1" FT /translation="MFPRTGDRWLASHVRYSQYYTLI" FT CDS 135. .248 FT /codon_start=1 FT /db_xref="SPTREMBL:Q89781" FT /note="ORF IIB" FT /protein_id="AAA46402.1" FT /translation="MSATLSTTLSFEPPLSLLAEPGTWFADTMDFSKETLC" XX SQ Sequence 336 BP; 66 A; 82 C; 96 G; 92 T; 0 other; M20356 Length: 336 December 21, 2001 15:54 Type: N Check: 4317 .. 1 gttttgtttg atggagaatt gcgcagaggg gttatatctg cgtgaggatc 51 tgtcactcgg cggtgtggga tacctccctg ctaaggcggg ttgagtgatg 101 ttccctcgga ctggggaccg ctggcttgcg agtcatgtcc gctactctca 151 gtactacact ctcatttgag cccccgctca gtttgctagc agaacccggc 201 acatggttcg ccgataccat ggatttttcg aaagaaacac tctgttaggt 251 ggtatgagtc atgacgcacg cagggagagg ctaaggctta tgctatgctg 301 atctccgtga atgtctatca ttcctctgca ggaccc