Sequence of DPV Woolly monkey sarcoma virus

Squirrel monkey retrovirus-H, complete genome.

ACC No: M23385

Dated: 2007-05-03 | Length: 8785 | CRC: -474381652

                
ID   M23385; SV 1; linear; genomic RNA; STD; VRL; 8785 BP.
XX
AC   M23385;
XX
DT   06-JUL-1989 (Rel. 20, Created)
DT   03-MAY-2007 (Rel. 91, Last updated, Version 8)
XX
DE   Squirrel monkey retrovirus-H, complete genome.
XX
KW   .
XX
OS   Squirrel monkey retrovirus-H
OC   Viruses; Retro-transcribing viruses; Retroviridae; Orthoretrovirinae;
OC   Betaretrovirus.
XX
RN   [1]
RP   1-8785
RX   PUBMED; 3201749.
RA   Oda T., Ikeda S., Watanabe S., Hatsushika M., Akiyama K., Mitsunobu F.;
RT   "Molecular cloning, complete nucleotide sequence, and gene structure of the
RT   provirus genome of a retrovirus produced in a human lymphoblastoid cell
RT   line";
RL   Virology 167(2):468-476(1988).
XX
RN   [2]
RP   1-8785
RA   Oda T., Ikeda S., Watanabe S., Hatsushika M., Akiyama K., Mitsunobu F.;
RT   ;
RL   Submitted (24-MAR-1989) to the EMBL/GenBank/DDBJ databases.
RL   Department of Biochemistry, Okayama University Medical School, Japan
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .8785
FT                   /organism="Squirrel monkey retrovirus-H"
FT                   /mol_type="genomic RNA"
FT                   /isolation_source="passed in human LMB cell line"
FT                   /note="SMRV-HLB; SMRV-H"
FT                   /db_xref="taxon:11857"
FT   polyA_signal    332. .337
FT   CDS             645. .2867
FT                   /codon_start=1
FT                   /product="gag protein"
FT                   /note="Base 645 is the position of the first start codon in
FT                   the ORF; putative"
FT                   /db_xref="GOA:P21411"
FT                   /db_xref="InterPro:IPR000721"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR003322"
FT                   /db_xref="InterPro:IPR008916"
FT                   /db_xref="InterPro:IPR008919"
FT                   /db_xref="InterPro:IPR010999"
FT                   /db_xref="UniProtKB/Swiss-Prot:P21411"
FT                   /protein_id="AAA66451.1"
FT                   /translation="MGQASSHSENDLFISHLKESLKVRRIRVRKKDLVSFFSFIFKTCP
FT                   WFPQEGSIDSRVWGRVGDCLNDYYRVFGPETIPITTFNYYNLIRDVLTNQSDSPDIQRL
FT                   CKEGHKILISHSRPPSRQAPVTITTSEKASSRPPSRAPSTCPSVAIDIGSHDTGQSSLY
FT                   PNLATLTDPPIQSPHSRAHTPPQHLPLLANSKTLHNSGSQDDQLNPADQADLEEAAAQY
FT                   NNPDWPQLTNTPALPPFRPPSYVSTAVPPVAVAAPVLHAPTSGVPGSPTAPNLPGVALA
FT                   KPSGPIDETVSLLDGVKTLVTKLSDLALLPPAGVMAFPVTRSQGQVSSNTTGRASPHPD
FT                   THTIPEEEEADSGESDSEDDEEESSEPTEPTYTHSYKRLNLKTIEKIKTAVANYGPTAP
FT                   FTVALVESLSERWLTPSDWFFLSRAALSGGDNILWKSEYEDISKQFAERTRVRPPPKDG
FT                   PLKIPGASPYQNNDKQAQFPPGLLTQIQSAGLKAWKRLPQKGAATTSLAKIRQGPDESY
FT                   SDFVSRLQETADRLFGSGESESSFVKHLAYENANPACQSAIRPFRQKELSTMSPLLWYC
FT                   SAHAVGLAIGAALQNLAPAQLLEPRPAFAIIVTNPAIFQETAPKKIQPPTQLPTQPNAP
FT                   QASLIKNLGPTTKCPRCKKGFHWASECRSRLDINGQPIIKQGNLNRGQPQGPTTGMNSG
FT                   ASQFTPQYRQPTPALPVINHAATSQTSGEQQRAVQDWTSVPPPTQY"
FT   CDS             3368. .3640
FT                   /codon_start=1
FT                   /product="aspartyl protease"
FT                   /note="Base 3368 is the position of the first start codon
FT                   in the ORF; putative"
FT                   /db_xref="GOA:P21407"
FT                   /db_xref="UniProtKB/Swiss-Prot:P21407"
FT                   /protein_id="AAA66452.1"
FT                   /translation="MLKWEDSEGNNGHITPYVLPNLPVNLWGRDILSQMKLVMCSPNDT
FT                   VMTQMLSQGYLPGQGLGKNNQGITQPITITPKKDKTGLGFHQNLP"
FT   CDS             3888. .6284
FT                   /codon_start=1
FT                   /product="pol protein"
FT                   /note="Base 3888 is the position of the first start codon
FT                   in the ORF; putative"
FT                   /db_xref="GOA:P03364"
FT                   /db_xref="UniProtKB/Swiss-Prot:P03364"
FT                   /protein_id="AAA66453.1"
FT                   /translation="MVPMGALQPGLPSPVAIPLNYHKIVIDLKDCFFTIPLHPEDRPYF
FT                   AFSVPQINFQSPMPRYQWKVLPQGMANSPTLCQKFVAAAIAPVRSQWPEAYILHYMDDI
FT                   LLACDSAEAAKACYAHIISCLTSYGLKIAPDKVQVSEPFSYLGFELHHQQVFTPRVCLK
FT                   TDHLKTLNDFQKLLGDIQWLRPYLKLPTSALVPLNNILKGDPNPLSVRALTPEAKQSLA
FT                   LINKAIQNQSVQQISYNLPLVLLLLPTPHTPTAVFWQPNGTDPTKNGSPLLWLHLPASP
FT                   SKVLLTYPSLLAMLIIKGRYTGRQLFGRDPHSIIIPYTQDQLTWLLQTSDEWAIALSSF
FT                   TGDIDNHYPSDPVIQFAKLHQFIFPKITKCAPIPQATLVFTDGSSNGIAAYVIDNQPIS
FT                   IKSPYLSAQLVELYAILQVFTVLAHQPFNLYTDSAYIAQSVPLLETVPFIKSSTNATPL
FT                   FSKLQQLILNRQHPFFIGHLRAHLNLPGPLAEGNALADAATQIFPIISDPIHEATQAHT
FT                   LHHLNAHTLRLLYKITREQARDIVKACKQCVVATPVPHLGVNPRGLVPNAIWQMDVTHF
FT                   TPFGKQRFVHVTVDTFSGFILATPQTGEASKNVISHVIHCLATIGKPHTIKTDNGPGYT
FT                   GKNFQDFCQKLQIKHVTGIPYNPQGQGVVERAHQTLKNALNRLARSPLGFSMQQPRNLL
FT                   SHALFQLNFLQLDSQGRSAADRLWHPQTSQQHATVMWRDPLTSVWKGPDPVLIWGRGSA
FT                   CIYDQKEDGPRWLPERLIRHINNQTAPLCDRPSNPNTAPGPKGSP"
FT   CDS             6314. .8041
FT                   /codon_start=1
FT                   /product="envelope glycoprotein"
FT                   /note="Base 6314 is the position of the first start codon
FT                   in the ORF; putative"
FT                   /db_xref="GOA:P21412"
FT                   /db_xref="InterPro:IPR002050"
FT                   /db_xref="UniProtKB/Swiss-Prot:P21412"
FT                   /protein_id="AAA66454.1"
FT                   /translation="MLCILILLLHPRLCPVTKGGLGKPSGDIYTALFGAPCDCKGGTQT
FT                   NNYATPTYTQVTDCGDKNAYLTYDTNWNGVSSPKWLCVRKPPSIPVINGRPGPCPSECT
FT                   NNIKSQMHSSCYSSFSQCTQGNNTYFTAILQRTKSTSETNPVTSGLQPHGVLQAGCDGT
FT                   VGKSVCWNQQAPIHVSDGGGPQDAVRELYVQKQIELVIQSQFPKLSYHPLARSKPRGPD
FT                   IDAQMLDILSATHQALNISNPSLAQNCWLCLNQGTSMPLAFPVNISSFNASQNNCTPSL
FT                   PFRVQPMPSQVYPCFFKGAQNNSFDIPVGVANFVNCSSSSNHSEALCPGPGQAFVCGNN
FT                   LAFTALPANWTGSCVLAALLPDIDIISGDDPVPIPTFDYIAGRQKRAVTLIPLLVGLGV
FT                   STAVATGTAGLGVAVQSYTKLSHQLINDVQALSSTINDLQDQLDSLAEVVLQNRRGLDL
FT                   LTAEQGGICLALQERCCFYANKSGIVRDKIKNLQEDLEKRRKALADNLFLTGLNGLLPY
FT                   LLPFLGPLFAIILFFSFAPWILRRVTALIRDQLNSLLGKPIQIHYHQLATRDLEYGRL"
FT   mat_peptide     6314. .7471
FT                   /product="outer membrane protein"
FT   mat_peptide     7472. .8038
FT                   /product="transmembrane protein"
FT   LTR             8661. .8666
FT                   /note="3' long terminal repeat"
FT   polyA_signal    8661. .8666
XX
SQ   Sequence 8785 BP; 2298 A; 2620 C; 1734 G; 2133 T; 0 other;

m23385 Length: 8785  03-MAY-2007  Type: N  Check: 4659  ..

       1  tgttgggaac ccaggctaag ctgatgctat tggaacaaaa ggttgcatca
      51  gccctccccg ccaaaagcat gccccgggcg tggtggcggg ccaccaatgg
     101  aggacctgat cacgggcaag acatgcctca gggccaccaa tggaggacct
     151  gatcacgggc aagacatgcc tcagggccac caataaagga cctgatcacg
     201  cacagaacat gcatggctgc accaatgggg tagctgatca tgagctaaac
     251  actcgtctcc cagcctatca gaactacttc ccctttcccc tctctacccg
     301  ctcccctccc tatataagga acccattttg aaataaactt tgcagcttga
     351  tcagaacttt tgtcttgctg ccattcttcg cgcctcttgt cccatccctt
     401  tctcatccac gacaggcttg ctcgggttcc tgtttgttgc tctgcgggac
     451  agagcaagtg gcgcccagga cgtggggctc gatgccggcc tccgtggacc
     501  gccgtcccct gtaaccggtt ccctgcacgg ccgtcccgat taaccgattc
     551  cccgcacgga gcaccgcgga ccacccgacc gcgagccgac tcctggagtt
     601  cgttcctcat ttcgacggcg gcattactca agtaagaccc aatcatggga
     651  caagcatctt cacacagtga aaatgatctc tttataagtc acttaaagga
     701  atctctcaag gtgcgtagaa ttcgggttcg caagaaagac cttgtctcct
     751  tttttagttt catttttaaa acatgtccat ggttccccca ggaagggtct
     801  attgactccc gtgtttgggg acgtgttggt gattgtctga acgactatta
     851  ccgtgttttt ggtcctgaga ctattccgat caccactttt aattattata
     901  atttaataag ggacgtcctt actaatcaga gcgactcccc tgacattcaa
     951  cgcctctgca aggagggtca caaaattctt attagccact cccgacctcc
    1001  atctagacaa gcccctgtaa caattaccac ctctgaaaag gcctcctctc
    1051  gccctccctc tagggcccct tctacctgcc cctcggttgc aattgacatt
    1101  ggttcacatg atacagggca gtcttcactg taccccaacc ttgcaaccct
    1151  tacggacccc cccattcaaa gtcctcattc tcgggcgcat actccgcccc
    1201  aacatttgcc cttgcttgct aattctaaaa ccttgcataa ctcgggtagt
    1251  caggatgatc aactaaatcc cgccgatcaa gcagatctgg aagaggcagc
    1301  tgcccaatat aacaaccctg attggcccca attaactaac accccggcat
    1351  tgccaccttt ccggccaccg tcctatgttt ctacagcagt gcccccagtg
    1401  gcagttgcgg ctcctgtttt gcatgcccct acttcaggcg ttcctggttc
    1451  ccccacggcc ccaaacttgc ccggtgtagc cctagccaaa ccctccggtc
    1501  ccattgatga gactgtttct cttcttgatg gggttaaaac cttagtcaca
    1551  aaactgtccg atttggccct tctacctccc gcgggagtta tggcttttcc
    1601  cgttaccaga agtcagggac aggttagctc caataccacg ggccgagcgt
    1651  ctcctcaccc tgacacacac accatccctg aggaggagga agcagactcc
    1701  ggagaatctg actcagagga tgacgaggag gaaagctcag agcccaccga
    1751  gcctacctac acccattcct ataagcggct aaatctaaag accatagaaa
    1801  aaattaaaac tgctgttgct aactatggtc ctactgcccc ctttaccgtg
    1851  gcccttgtag agagtcttag tgaaagatgg cttaccccta gtgattggtt
    1901  tttcttgtct cgtgctgcgc tgagcggagg ggacaatatc ctttggaagt
    1951  ctgagtatga ggatatttcc aaacagtttg cagagcgaac gcgcgtaagg
    2001  cctcctccaa aggatggacc cttaaaaatt cctggcgcca gcccttatca
    2051  gaacaatgac aaacaggccc aattcccccc agggctttta acccagattc
    2101  agtccgcagg cctaaaagcc tggaagcgac tccctcaaaa gggagcggct
    2151  actacttccc ttgcaaagat tagacaaggc cccgatgagt catacagtga
    2201  ttttgtaagc cgcctccagg agacggcaga tcgccttttt ggctccgggg
    2251  aaagtgagag ctcctttgta aaacacctag cctatgaaaa cgctaacccc
    2301  gcttgccaaa gtgcaattcg gccttttagg cagaaggagc tttcgactat
    2351  gtcgcctctg ctctggtatt gctctgccca tgctgttggc ctagccatag
    2401  gagctgccct ccaaaatctt gcccccgcgc aactcctgga gcccaggccc
    2451  gcctttgcta taattgtcac caacccggcc atctttcaag aaactgcccc
    2501  caaaaaaata caaccaccta ctcaactccc aactcaacct aatgccccac
    2551  aggctagcct tataaaaaat ttaggtccca caacaaaatg tcctcgctgc
    2601  aaaaaaggat ttcactgggc ttcagaatgc cgttctcgat tagacattaa
    2651  tggacaaccc attattaagc agggaaactt gaacaggggc cagccccagg
    2701  gccccactac cgggatgaac tccggggctt cacagttcac cccccaatac
    2751  cgccagccaa cccctgccct cccagtaatc aaccacgccg ctacgtcaca
    2801  gacctctggc gagcaacagc gggcagtgca ggactggacc tctgtaccac
    2851  caccgacaca atactaacca cccaaaatag ccctctgaca cttccagttg
    2901  gaatatatgg acccttacca ccccagacat tcggcctcat attagcagag
    2951  ccagctctac cctccaaggg gatccaagtt ctgcccggca tattagacaa
    3001  tgattttgag ggagaaatcc atatcattct ctctacaact aaagatttag
    3051  tcaccatccc aaagggcacc agactagctc aaatagtcat tctccccctc
    3101  caacaaatta actccaattt ccataagccc taccgcgggg ctagtgcccc
    3151  tgggtcttct gatgtctact gggttcaaca aatttctcaa cagcggccta
    3201  ccctgaaact taaattaaat ggtaagctct tttctggcat tcttgataca
    3251  ggggccgatg ccaccgttat atcttacact cactggccga ggaactggcc
    3301  gttaacaacc gttgctactc acctgcgcgg tattggccag gccaccaacc
    3351  cccaacaaag tgctcaaatg cttaagtggg aggactctga aggcaataat
    3401  ggtcacatta ccccttatgt cctccccaat ctgccagtca atctctgggg
    3451  aagggacatc ctctctcaaa tgaaacttgt catgtgcagt cccaacgata
    3501  ctgtcatgac ccaaatgcta agccaggggt atctccccgg ccaagggttg
    3551  ggaaaaaata atcaaggaat cacccagccc attactatta cccccaaaaa
    3601  agacaaaaca ggcctaggat tccaccaaaa tttaccgtag tcgtgccatt
    3651  gacattcctg taccccacgc tgacaaaatt tcctggaaaa ttacagaccc
    3701  tgtgtgggtt gatcagtggc cacttacata tgagaaaacc ctcgctgcca
    3751  ttgcgttagt acaggaacag ctcgcagcag gacatattga gcccacaaat
    3801  tctccatgga atactcctat attcatcatt aagaaaaaat caggtagctg
    3851  gcgtctttta caggatctaa gagccgttaa taaggtaatg gtccccatgg
    3901  gagcccttca gcctggtctt ccctctcctg tagccatccc cctaaactat
    3951  cacaaaattg ttattgacct taaggattgt ttctttacca tccccttaca
    4001  ccctgaagac agaccttact ttgcctttag cgtccctcaa atcaacttcc
    4051  aaagtcctat gcctcgttat cagtggaagg ttctgccaca gggcatggcc
    4101  aacagtccca cactgtgcca aaaatttgtt gctgccgcca ttgccccagt
    4151  aagatcccag tggccagagg cctatatcct ccattatatg gatgacatcc
    4201  ttcttgcttg tgacagcgcc gaggcagcca aggcctgcta tgctcacatt
    4251  atatcctgtc ttacctcata tggactaaaa attgctccag acaaggtaca
    4301  agtgtctgag ccattttctt atttaggatt tgagttacac catcagcaag
    4351  tatttactcc ccgagtctgc ttaaaaactg atcacttaaa aacccttaac
    4401  gatttccaaa aattactcgg ggacattcag tggcttcgac cctatttaaa
    4451  attgcccacc agtgcccttg ttccccttaa caatattcta aaaggcgatc
    4501  caaatccttt atcggttcga gcactgaccc cagaggcaaa gcaatctcta
    4551  gccctcatca acaaggctat ccaaaatcaa agtgttcaac aaatttcgta
    4601  taaccttccc ctagtactcc tcttgctccc aactccccat acacccaccg
    4651  cggtgttttg gcaaccaaac ggtacagacc ctacaaaaaa cggaagcccc
    4701  ctcctttggc tccatctacc tgcctcccca tcaaaagtct tactcaccta
    4751  cccctcgctc ctcgccatgt taattattaa gggtcggtac actggccgcc
    4801  aactgtttgg cagggacccc cactctataa tcattccata cacccaggac
    4851  caattaacct ggctcctgca aacctctgac gaatgggcca ttgcattatc
    4901  ctccttcaca ggagacatag acaatcatta ccccagtgac cctgttatcc
    4951  aatttgccaa gcttcaccag ttcatattcc ccaagatcac aaaatgtgcc
    5001  ccaattcctc aagccacgct agttttcact gatggatcct caaacggaat
    5051  tgctgcatat gttattgata atcaacccat ctcaataaaa tccccctacc
    5101  tgtcagctca acttgttgag ctctatgcta ttctccaggt gttcacagtt
    5151  ctagctcacc aaccgtttaa cttgtacact gacagtgcgt atattgctca
    5201  atcagtccct cttttggaga cagtcccctt tatcaaatcc tcaaccaatg
    5251  ctaccccctt attttctaaa ctgcaacagc taattttaaa cagacaacac
    5301  cctttcttta tcggacatct tcgggcccac ctaaatcttc caggacccct
    5351  ggctgaaggc aatgccttag ctgatgctgc cacacagatt ttccccatta
    5401  taagtgaccc aatacatgag gctactcaag ctcacaccct acatcacctc
    5451  aatgcacaca ccctacgatt actctataaa attactagag aacaagccag
    5501  agatattgta aaagcttgca aacagtgtgt cgtagccacc cctgtacccc
    5551  atcttggcgt gaacccccgt ggtttagtcc ccaatgccat ttggcaaatg
    5601  gatgtcactc attttactcc ttttggaaaa cagaggtttg ttcatgttac
    5651  tgttgacaca tttagtggtt ttatcttagc cactccccaa acaggtgaag
    5701  catcaaaaaa tgttatatct catgttatcc actgtcttgc taccatagga
    5751  aaaccacaca ccattaaaac agacaatggc ccgggatata ctggaaaaaa
    5801  cttccaagac ttttgccaaa aactccaaat caaacatgtt actggtatac
    5851  cgtacaaccc ccagggtcaa ggagtagttg aacgagctca tcaaacatta
    5901  aaaaatgccc taaatcgctt agcccgctcc ccccttgggt tttctatgca
    5951  acaacccaga aaccttctta gtcatgccct atttcaacta aattttctac
    6001  agcttgacag tcaagggcgc tcggcagctg accgtctatg gcatccccaa
    6051  acttctcagc agcatgctac ggttatgtgg cgtgaccctc tcaccagtgt
    6101  ttggaagggc cctgaccctg tcctcatatg ggggcgaggc tcagcctgca
    6151  tatacgatca aaaggaggat ggcccccgct ggctccctga gcgactaatt
    6201  agacacatca ataatcagac agcccccttg tgtgacaggc caagtaaccc
    6251  aaatacagcc ccagggccaa aaggctcgcc ctgaggagct ccttttctct
    6301  tcttccagga agaatgctct gcatcctcat cctcctactg cacccacgcc
    6351  tctgcccagt cacaaaggga ggacttggaa agccatccgg agacatttac
    6401  actgccctct ttggagcgcc atgtgactgt aaagggggga ctcagaccaa
    6451  taattacgcc accccaactt acactcaggt aacagattgt ggggacaaaa
    6501  atgcctatct tacctatgac accaattgga atggagtatc ttcacctaag
    6551  tggctttgtg tgcgcaagcc tcctagtata ccggtcatta atggccgccc
    6601  aggcccgtgc ccaagcgagt gcacaaacaa cattaaatcc cagatgcact
    6651  cctcctgcta ttctagtttc tcacagtgta ctcaaggcaa taatacttat
    6701  tttactgcca ttctacaaag aacaaagagc acctcagaaa ccaatcctgt
    6751  caccagcggc ctacaacctc atggggtcct ccaggccgga tgcgatggca
    6801  cggttggaaa atcggtttgt tggaatcagc aagcccctat tcacgtctcc
    6851  gacggtggcg gaccccaaga tgctgtgaga gagctttatg tacaaaaaca
    6901  aatagagctt gttattcaaa gccaattccc taagttatcc taccaccccc
    6951  tagctcgctc aaaaccaaga ggacctgaca ttgatgcaca aatgcttgat
    7001  attctgtcag ccacccacca ggccctcaat atctccaacc ccagcctagc
    7051  ccaaaattgc tggttatgct taaatcaagg tacctccatg cccctagcct
    7101  tccctgtcaa tatatctagt tttaatgcct cacaaaataa ttgcaccccc
    7151  agcttaccct ttagagtcca gcccatgcct tcccaagtat acccttgctt
    7201  ctttaaaggt gcacaaaaca acagctttga tattccggtt ggcgttgcca
    7251  actttgtaaa ctgctccagt agttccaacc acagtgaggc cctttgccct
    7301  ggcccaggcc aagcttttgt ttgcggcaac aacctcgcct ttactgctct
    7351  gcctgcaaac tggacagggt catgtgtgtt agccgccctc ctgccagata
    7401  tagacattat ttctggtgat gaccctgtcc ctatccctac ctttgactat
    7451  attgcagggc ggcagaaacg agccgttaca ctgattcccc tgctagtagg
    7501  attgggtgtc tctacagcag tcgctaccgg tacagcagga ctcggggtgg
    7551  ctgttcaatc ttacacaaaa ctttcccatc aacttattaa cgacgtccaa
    7601  gccttgtcta gcaccattaa tgacttacag gaccaactag attccctagc
    7651  cgaagtagtc ctccaaaaca gaagaggctt agacctactc actgcagaac
    7701  agggaggtat ctgtttggct ctacaggaac gttgctgctt ttatgccaac
    7751  aagtcaggaa ttgtccgaga taaaataaaa aatctacaag aagacctcga
    7801  aaaaagacgc aaggcacttg cagacaatct cttcctcacc ggcctcaatg
    7851  gacttctccc ttacctcctc cccttccttg gacccttatt cgctatcatc
    7901  ctgttcttct cttttgcccc ttggatccta agacgagtaa cagcgttaat
    7951  cagggatcag ctcaattccc tactgggaaa gcccatacaa atccactatc
    8001  accaactagc aacgcgtgat ctagaatatg gcagactgta gccggttccc
    8051  ctcctacggg agcagcatac cgctcgacac tatgctttac gaaggtaatg
    8101  gacaccgcta ggtgcaaggc aaggcactgc aaggagaggc cttactaagg
    8151  ctactgtcga gtctcctgag aggtaagctg gcttgcatag aggttggtac
    8201  tcgaaaaatc ctctcctccc aaaaaggtac ctgtaagcct gaaaattaag
    8251  gctcaggagg agcacagcct ctacctcccc tagctggtta aggtccgcct
    8301  cctctttttt taaagaaaaa gggaggagat gttgggaacc caggctaagc
    8351  tgatgctatt ggaacaaaag gttgcatcag ccctccccgc caaaagcatg
    8401  ccccgggcgt ggtggcgggc caccaatgga ggacctgatc acgggcaaga
    8451  catgcctcag ggccaccaat ggaggacctg atcacgggca agacatgcct
    8501  cagggccacc aataaaggac ctgatcacgc acagaacatg catggctgca
    8551  ccaatggggt agctgatcat gagctaaaca ctcgtctccc agcctatcag
    8601  aactacttcc cctttcccct ctctacccgc tcccctccct atataaggaa
    8651  cccattttga aataaacttt gcagcttgat cagaactttt gtcttgctgc
    8701  cattcttcgc gcctcttgtc ccatcccttt ctcatccacg acaggcttgc
    8751  tcgggttcct gtttgttgct ctgcgggaca gagca