Sequence of DPV Cucumber necrosis virus

Cucumber necrosis virus, complete genome.

ACC No: M25270

Dated: 2005-04-17 | Length: 4701 | CRC: -1035170449

                !!NA_SEQUENCE 1.0
ID   CNVGENO    standard; genomic RNA; VRL; 4701 BP.
XX
AC   M25270;
XX
SV   M25270.1
XX
DT   23-NOV-1989 (Rel. 21, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 6)
XX
DE   Cucumber necrosis virus, complete genome.
XX
KW   coat protein; complete genome; readthrough protein; replicase.
XX
OS   Cucumber necrosis virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Tombusvirus.
XX
RN   [1]
RP   1-4701
RX   MEDLINE; 89204896.
RX   PUBMED; 2705296.
RA   Rochon D.M., Tremaine J.H.;
RT   "Complete nucleotide sequence of the cucumber necrosis virus genome";
RL   Virology 169(2):251-259(1989).
XX
RN   [2]
RX   MEDLINE; 91196257.
RX   PUBMED; 2014641.
RA   Rochon D.M., Johnston J.C.;
RT   "Infectious transcripts from cloned cucumber necrosis virus cDNA: Evidence
RT   for a bifuntional subgenomic mRNA";
RL   Virology 181(2):656-665(1991).
XX
CC   Draft entry and computer-readable sequence for [1] kindly submitted
CC   by D.Rochon, 25-OCT-1989.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .4701
FT                   /db_xref="taxon:12143"
FT                   /mol_type="genomic RNA"
FT                   /organism="Cucumber necrosis virus"
FT   exon            <152. .1039
FT                   /note="replicase (put.; readthrough protein); putative"
FT   CDS             152. .1042
FT                   /codon_start=1
FT                   /db_xref="UniProt/TrEMBL:Q66164"
FT                   /note="ORF p33"
FT                   /protein_id="AAA42903.1"
FT                   /translation="MDTIKRMLWPKKEIFVGTFATGVERDTSVDIFQLVCRVVLRYMRT
FT                   GKIENNTDSLGNFIVELLKTDCAAKWEWFMKRRRVGDYAKSLAIASIPVIPLLSYATMK
FT                   KTVALRAFGNELSFNIRVPRPSVPKKGLLLRLAAGLALAPICALAMYATLPREKLSVFK
FT                   LRTEARAHMEDEREATDCLVVEPARELKGKDGEDLLTGSRMTKVIASTGRPRRRPYAAK
FT                   IAQVARAKVGYLKNTPENRLIYQRVMIEIMDKDCVRYVDRDVILPLAIGCCFVYPDGVE
FT                   ESAALWGSDESLGVK"
FT   CDS             join(152. .1039,1043. .2608)
FT                   /codon_start=1
FT                   /db_xref="GOA:P15187"
FT                   /db_xref="InterPro:IPR002166"
FT                   /db_xref="InterPro:IPR007094"
FT                   /db_xref="InterPro:IPR007095"
FT                   /db_xref="UniProt/Swiss-Prot:P15187"
FT                   /note="replicase (put.; readthrough protein); putative"
FT                   /protein_id="AAA42902.1"
FT                   /translation="MDTIKRMLWPKKEIFVGTFATGVERDTSVDIFQLVCRVVLRYMRT
FT                   GKIENNTDSLGNFIVELLKTDCAAKWEWFMKRRRVGDYAKSLAIASIPVIPLLSYATMK
FT                   KTVALRAFGNELSFNIRVPRPSVPKKGLLLRLAAGLALAPICALAMYATLPREKLSVFK
FT                   LRTEARAHMEDEREATDCLVVEPARELKGKDGEDLLTGSRMTKVIASTGRPRRRPYAAK
FT                   IAQVARAKVGYLKNTPENRLIYQRVMIEIMDKDCVRYVDRDVILPLAIGCCFVYPDGVE
FT                   ESAALWGSDESLGVKGGLVRLPGVVTQTNRDIPSGVLLPQEVLEVRAGPPNAKDRNIFM
FT                   VAGCPSQARFLVHNHCLKNLKRGLVERVFCVERNGQLTRTPQPTKGAFGRLSPFRKAVC
FT                   EKVGVAHRLGYDGFLSYYSGAKLRTYTRAVESLHITPVSERDSHLTTFVKAEKISTAKG
FT                   DPAPRVIQPRNPRYNVELGRYLRHMESKLMKAVDGVFGETTCIKGYTADEVGQIFRDKW
FT                   DRFNKPVAIGLDASRFDQHCSVEALQFEHGFYRAMYPGNKLLSKLLDWQLHNKGKGYVP
FT                   DGTITYRKEGCRMSGDINTSLGNYLLMCAMIYGYMRHLGINEYSLANCGDDCVLIVERR
FT                   NLKQIQGTLPEYFLNLGYTMKVEPPVFQLEEVEFCQAHPVQFQGGWKMVRNVRTAMSKD
FT                   VHCVNNIRDLATRRAWSNAQHHGGVALTSGIPVVEKFYSRFTLYEVPKKHQRIDTVTNV
FT                   HKWRGSGGDYVVTPEARASFWAAFGLTGDEQLALEDRLDRWEMDLFGEEGVDAHEPSIL
FT                   DSAVA"
FT   misc_feature    1040. .1042
FT                   /note="readthrough codon"
FT   exon            1043. .>2608
FT                   /note="replicase (put.; readthrough protein); putative"
FT   CDS             2628. .3770
FT                   /codon_start=1
FT                   /db_xref="GOA:P15183"
FT                   /db_xref="HSSP:2TBV"
FT                   /db_xref="InterPro:IPR000937"
FT                   /db_xref="InterPro:IPR008975"
FT                   /db_xref="UniProt/Swiss-Prot:P15183"
FT                   /note="coat protein"
FT                   /protein_id="AAA42904.1"
FT                   /translation="MALVSRNNNMRTLAKLAAPLATAGTRTIVDNKEAIWNGVKWIWGK
FT                   LPKGKKGKNGNGALIAHPQAFPGAIAAPISYAYAVKGRKPRFQTAKGSVRITHREYVSV
FT                   LSGTNGEFLRNNGTGPNNDFSINPLNPFLFPWLVNIAANFDQYKFNSLRFEYVPLVNTT
FT                   TNGRVALYFDKDSEDPGPDDRAALANYAHLSEISPWAITKLTVPTDNVKRFISDTSSGD
FT                   PKLINLGQFGWVAYSGPTAELGDIFVEYTVDLFEAQPTSPLLESLFRESASSVQTRMGL
FT                   PYFSLEVASATDLVWQARVPGTYVVTIIFNSTVGGLTPSISGGGTINSSFSVSTAGSSA
FT                   YVANITIRVNANLSLSGLTGATNAQLFAVRAITENAVQVV"
FT   CDS             3800. .4372
FT                   /codon_start=1
FT                   /db_xref="GOA:P15185"
FT                   /db_xref="InterPro:IPR005332"
FT                   /db_xref="UniProt/Swiss-Prot:P15185"
FT                   /note="ORF p21"
FT                   /protein_id="AAA42905.1"
FT                   /translation="MDTEYEQVNKPWNELYKEATLGNKLTVNVGMEDVEVPLLPSNFLT
FT                   KVRVSLSGGYITVRRVRIKIIPLVSRKAGVSGKLYLRDISDTTGRKLHCTELLDLGKEI
FT                   RLTMQHLDFSVSARSDVPIVFGFEDLVSPYLEGRELFSVSLRWQFGLSAQCYSLPPAKW
FT                   KVMYQEDALKALKPSKIKKASKTDSSV"
FT   CDS             3832. .4353
FT                   /codon_start=1
FT                   /db_xref="GOA:P15184"
FT                   /db_xref="HSSP:1R9F"
FT                   /db_xref="InterPro:IPR004905"
FT                   /db_xref="UniProt/Swiss-Prot:P15184"
FT                   /note="ORF p20"
FT                   /protein_id="AAA42906.1"
FT                   /translation="MERAIQRSDAREQANSERWDGRCGGTITPFKLPDESPSLLEWRLH
FT                   NSEESEDKDHPLGFKESWSFGKVVFKRYLRYDGTETSLHRTLGSWERNSVNDAASRFLG
FT                   VSQIGCTYSIRFRGSCLTLSGGSRTLQRLIEMAIRTKRTMLQLTPCEVEGNVSRRRPQG
FT                   SEAFENKESE"
XX
SQ   Sequence 4701 BP; 1228 A; 1007 C; 1291 G; 1173 T; 2 other;

   M25270  Length: 4701  May 10, 2005 10:09  Type: N  Check: 6576  ..

       1  nnaaattctc caggatttct caaccttggt tgtgctatct ggtgacttgc
      51  gcgtgttgtc tgcgtagaga atttctctcc ttaaccaaaa ggggtttgaa
     101  gactgggtct accgcttgcg ggataaattg taacttccag taaacgacga
     151  catggatacc atcaagagga tgctgtggcc taagaaagaa atttttgttg
     201  gcacgttcgc gaccggagtg gaaagggaca cctcggtgga catcttccaa
     251  ttagtgtgta gggttgtgtt gagatacatg aggacaggga aaatcgagaa
     301  taacactgac agtctgggaa atttcatcgt tgaacttctc aagacagatt
     351  gtgcagccaa atgggaatgg ttcatgaaac gcaggagggt tggtgattac
     401  gccaagtcac tcgccattgc ttccatccca gttattccgt tgcttagcta
     451  tgccacgatg aagaagaccg ttgcgcttcg ggcctttggt aatgaactct
     501  cgttcaacat cagggttcca aggccatcag tacctaagaa aggcttgcta
     551  ctgcgactgg cggcaggact agcgttagca cccatttgcg cactagccat
     601  gtacgctacc ctacccaggg aaaaactgtc ggtatttaag cttcgcactg
     651  aagcccgagc acatatggag gatgaaaggg aagcgacgga ttgtttggtg
     701  gttgagccgg cacgggagct taagggtaag gatggagagg atctcctcac
     751  tggcagtagg atgacaaagg taattgcgtc cacaggacgc cctcgcagaa
     801  gaccttatgc agctaagatt gcacaggtag cgagagccaa ggtgggttac
     851  ctgaagaaca ctcctgagaa tagattgata taccagagag tgatgatcga
     901  gatcatggac aaagattgcg tcaggtatgt tgacagggat gtcatattac
     951  cattggctat tggatgctgc tttgtctacc cggatggagt ggaggagtcg
    1001  gccgcacttt ggggctcgga tgagtccctt ggtgtgaaat agggaggcct
    1051  agtacgtcta cctggggttg tgacacagac caatcgagat atcccatctg
    1101  gtgtgttact tccccaggaa gtgctagagg ttcgtgcagg acctcccaat
    1151  gctaaggacc gtaacatatt catggttgcg ggttgcccat cacaggcgcg
    1201  gttcttagta cacaatcatt gcctgaaaaa cctgaaaagg ggtcttgtgg
    1251  agagagtttt ctgtgtcgag aggaacggtc aactcactcg cactccacaa
    1301  cctaccaaag gagcctttgg acgtctttcc ccgttcagga aagcggtctg
    1351  cgagaaggtc ggggttgccc accgtttggg gtatgatgga tttctatcat
    1401  actacagtgg tgcgaagctc cgtacttaca cgcgggctgt ggagagtctg
    1451  catatcacac ctgtctctga gagggatagt cacttgacta cctttgtcaa
    1501  ggcagagaag atatcgacgg ccaaaggtga cccagcacct agggtgattc
    1551  agcctcgaaa ccctaggtac aatgtggagc ttggaagata tctgcggcat
    1601  atggaatcca aacttatgaa agctgtggat ggcgtatttg gtgaaaccac
    1651  atgcattaaa ggttatactg ctgatgaggt ggggcagatt ttccgggata
    1701  aatgggatag gtttaataaa cccgtcgcta tcggtctcga tgcctcacgg
    1751  tttgatcaac actgttccgt ggaggccttg caatttgagc atggtttcta
    1801  cagggccatg taccctggca ataagctttt gagcaagttg ttggactggc
    1851  aactccataa caaagggaaa ggttatgtgc ctgacggcac aataacttac
    1901  cgtaaggagg gttgccgcat gagtggggat ataaacacgt cacttggtaa
    1951  ttatctttta atgtgtgcta tgatctacgg gtatatgcgc catttgggga
    2001  tcaatgaata cagtctggcg aactgcgggg atgactgcgt tctcattgtg
    2051  gagcgtagga atcttaagca gatacagggt acactgcctg agtatttcct
    2101  aaatttgggt tatacgatga aggtggaacc acctgtattt caattggaag
    2151  aggttgaatt ctgtcaggca cacccagtgc agtttcaagg tggttggaag
    2201  atggtccgga acgtcagaac agccatgagc aaggatgttc actgtgttaa
    2251  taatattagg gatttggcca caaggagggc gtggagtaat gctcagcatc
    2301  atggcggggt tgcgcttact agcggtattc ctgttgtgga gaaattttac
    2351  tccagattta cactctatga agtccctaag aagcaccagc gcatagacac
    2401  agtgacaaat gtgcacaaat ggcgtggttc tggcggtgac tatgttgtga
    2451  cccctgaggc aagggcgagc ttttgggctg cctttggact cacgggggat
    2501  gagcagctgg cactagagga ccgattggac agatgggaaa tggatctttt
    2551  tggagaggag ggtgttgacg cgcatgagcc cagcatcctt gactccgccg
    2601  tagcatgacc aagcaaacac aaacacaatg gcactcgtaa gcaggaacaa
    2651  caatatgcga acacttgcaa agttagccgc cccattggct acggcaggga
    2701  cacgcacgat agtggacaat aaagaagcta tctggaatgg agtaaaatgg
    2751  atctggggaa agttaccgaa aggcaagaaa ggtaagaatg gaaacggtgc
    2801  tctcatagcc cacccacagg cttttcctgg ggctatcgcc gcgccaatct
    2851  cttatgccta tgcggttaaa ggaaggaaac ctaggtttca aacagcaaaa
    2901  ggatctgtgc gaataaccca tagagagtat gtgtcggttc tttccggcac
    2951  taatggggag ttcctacgca acaacgggac tggaccgaac aacgatttca
    3001  gcattaatcc gctgaaccct ttcttgttcc cgtggcttgt aaatattgcc
    3051  gccaactttg atcagtacaa gttcaacagt ttgaggttcg agtatgtacc
    3101  gcttgttaat acaacgacta atggccgtgt agctttatat tttgataagg
    3151  atagcgagga ccctggcccc gatgataggg ctgcccttgc gaactatgct
    3201  cacttgagtg agatatctcc ttgggcgata acaaagctta ccgtgcctac
    3251  agacaatgtc aagcggttca tcagtgacac ctcgtcgggt gacccgaagc
    3301  tgatcaacct tgggcagttt ggatgggtcg cttatagcgg ccctacagct
    3351  gagttggggg atattttcgt agagtacaca gtagatctct ttgaggcaca
    3401  accaacgtcg cctcttctgg aatcgttgtt ccgggagagc gctagtagtg
    3451  tgcaaacgag aatgggttta ccttactttt ccctggaggt ggcttcggct
    3501  accgaccttg tatggcaggc acgtgtgccc ggcacatatg tggttaccat
    3551  tatcttcaac agtacagtcg gggggctcac accgtccatt tctggaggtg
    3601  ggactattaa tagttccttt agtgtgagca ccgccggaag ctctgcatat
    3651  gttgcaaaca tcactatacg tgtgaatgcc aacttgagtc tttctgggct
    3701  cacgggagcg acaaacgcgc agctctttgc ggtgcgagca atcactgaaa
    3751  atgcggtgca ggttgtgtaa attaggggct tcttgaatct aaccaattca
    3801  tggatactga atacgaacaa gtcaataaac catggaacga gctatacaaa
    3851  gaagcgacgc tagggaacaa gctaacagtg aacgttggga tggaagatgt
    3901  ggaggtacca ttactccctt caaacttcct gacgaaagtc cgagtctcct
    3951  tgagtggagg ctacataaca gtgaggagag tgaggataaa gatcatcccc
    4001  ttggtttcaa ggaaagctgg agtttcggga aagttgtatt taagagatat
    4051  ctcagatacg acgggacgga aacttcattg cacagaactc ttggatcttg
    4101  ggaaagaaat tcggttaacg atgcagcatc tcgatttctc ggtgtcagcc
    4151  agatcggatg tacctatagt attcggtttc gaggatcttg tctcacctta
    4201  tctggagggt cgcgaactct tcagcgtctc attgagatgg caattcggac
    4251  taagcgcaca atgttacagc ttaccccctg cgaagtggaa ggtaatgtat
    4301  caagaagacg ccctcaaggc tctgaagcct tcgaaaataa agaaagcgag
    4351  taagacagac tcttcagtct gacttggtgg aatcttgcga atttaactgt
    4401  tactcttcat gggttccttc ccatacgatg acgagtcagg tcgggcccta
    4451  tcttaggttt ggtcacctag gggacgggga tatggaaatc actttcgctt
    4501  gctgtcagtc tagtggaaac acttagcttg caatgtgggt gtatgcctgg
    4551  ataagtcgta tggatgctgg ccatgatgaa ttggatgcag tttaggacgt
    4601  atagtggaaa tcttgccaga cacggttgat ctcaccctcc ggggggctat
    4651  agagatcgct ggaacactac cggacaaccg gaacattgca gaaatgcagc
    4701  c