Sequence of DPV Saccharomyces cerevisiae virus L-A

Saccharomyces cerevisiae virus L-A L1 segment capsid protein and RNA polymerase gene, complete cds.

ACC No: M28353

Dated: 2000-03-29 | Length: 4580 | CRC: -576331235

                !!NA_SEQUENCE 1.0
ID   SCSL1A     standard; RNA; VRL; 4580 BP.
XX
AC   M28353; X13426;
XX
SV   M28353.1
XX
DT   02-FEB-1990 (Rel. 22, Created)
DT   29-MAR-2000 (Rel. 63, Last updated, Version 4)
XX
DE   Saccharomyces cerevisiae virus L-A L1 segment capsid protein and RNA
DE   polymerase gene, complete cds.
XX
KW   .
XX
OS   Saccharomyces cerevisiae virus L-A
OC   Viruses; dsRNA viruses; Totiviridae; Totivirus.
XX
RN   [1]
RP   1-4580
RX   MEDLINE; 89342639.
RA   Diamond M.E., Dowhanick J.J., Nemeroff M.E., Pietras D.F., Tu C.L.,
RA   Bruenn J.A.;
RT   "Overlapping genes in a yeast double-stranded RNA virus";
RL   J. Virol. 63(9):3983-3990(1989).
XX
RN   [2]
RP   1-4580
RA   Bruenn J.A., Diamond M.E., Dowhanick J.J., Nemeroff M.E., Pietras D.F.;
RT   ;
RL   Submitted (04-NOV-1988) to the EMBL/GenBank/DDBJ databases.
RL   Department of Biological Sciences, SUNY at Buffalo, 663 Cooke Hall,
RL   Buffalo, New York 14260, USA
XX
DR   SPTREMBL; Q87024; Q87024.
DR   SPTREMBL; Q87025; Q87025.
XX
CC   On Oct 8, 1994 this sequence version replaced gi:341907.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .4580
FT                   /chromosome="L1 segment"
FT                   /db_xref="taxon:11008"
FT                   /organism="Saccharomyces cerevisiae virus L-A"
FT                   /strain="L014"
FT   CDS             30. .2072
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:Q87024"
FT                   /product="capsid protein"
FT                   /protein_id="AAA50320.1"
FT                   /translation="MLRFVTKNSQDKSSDLFSICSDRGTFVAHNRVRTDFKFDNLVFNR
FT                   VYGVSQKFTLVGNPTVCFNEGSSYLEGIAKKYLTLDGGLAIDNVLNELRSTCGIPGNAV
FT                   ASHAYNITSWRWYDNHVALLMNMLRAYHLQVLTEQGQYSAGDIPMYHDGHVKIKLPVTI
FT                   DDTAGPTQFAWPSDRSTDSYPDWAQFSESFPSIDVPYLDVRPLTVTEVNFVLMMMSKWH
FT                   RRTNLAIDYEAPQLADKFAYRHALTVQDADEWIEGDRTDDQFRPPSSKVMLSALRKYVN
FT                   RNRLYNQFYTAAQLLAQIMMKPVPNCAEGYAWLMHDALVNIPKFGSIRGRYPFLLSGDA
FT                   ALIQATALEDWSAIMAKPELVFTYAMQVSVALNTGLYLRRVKKTGFGTTIDDSYEDGAF
FT                   LQPETFVQAALACCTGQDAPLNGMSDVYVTYPDLLEFDAVTQVPITVIEPAGYNIVDDH
FT                   LVVVGVPVACSPYMIFPVAAFDTANPYCGNFVIKAANKYLRKGAVYDKLEAWKLAWALR
FT                   VAGYDTHFKVHGDTHGLTKFYADNSDTWTHIPEFVTDGDVMEVFVTAIERRARHFVELP
FT                   RLNSPAFFRSVEVSTTIYDTHVQAGAHSVYHARRINLDYVKPVSTGIQVINAGELKNYW
FT                   GSVRRTQQGLGVVGLTMPAVMPTGEPTAGAAHEELIEQADNVLVE"
FT   CDS             <1940. .4546
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:Q87025"
FT                   /note="start; putative"
FT                   /product="RNA polymerase"
FT                   /protein_id="AAA50321.1"
FT                   /translation="CASYSAGFRSGRSYDASCNAYRRTYSWRCPRRVDRTGGQCFSRVN
FT                   VIEPSHGPRPTRYILQEPGTYPAWIRFRNRVQAVSRQKATHFLFDIVPAAVISDFTTSD
FT                   TSSFAYKSHTYAANVTALRFSDTYALYVQTDTNMTILSPAARRQASATYSQVAGFCYNT
FT                   PTVMDSLANILDVDRNIRPKHFKGLRLYTSSKVTAQHHTHLRPDELVEAAAKVSPRRKY
FT                   YLMCVVELLANLQVDLEAAVATILAYVLTLSEKFVPIFLDSRAIWVGEPGPDALTARLK
FT                   ASSGQIKSIHTADYEPLTELFELAVLMNRGVGHVSWQAEKDHRLNPDVAVVDQARLYSC
FT                   VRDMFEGSKQTYKYPFMTWDDYTANRWEWVPGGSVHSQYEEDNDYIYPGQYTRNKFITV
FT                   NKMPKHKISRMIASPPEVRAWTSTKYEWGKQRAIYGTDLRSTLITNFAMFRCEDVLTHK
FT                   FPVGDQAEAAKVHKRVNMMLDGASSFCFDYDDFNSQHSIASMYTVLCAFRDTFSRNMSD
FT                   EQAEAMNWVCESVRHMWVLDPDTKEWYRLQGTLLSGWRLTTFMNTVLNWAYMKLAGVFD
FT                   LDDVQDSVHNGDDVMISLNRVSTAVRIMDAMHRINARAQPAKCNLFSISEFLRVEHGMS
FT                   GGDGLGAQYLSRSCATLVHSRIESNEPLSVVRVMEADQARLRDLANRTRVQSAVTAIKE
FT                   QLDKRVTKIFGVGDDVVRDIHTAHRVCGGISTDTWAPVETKIITDNEAYEIPYEIDDPS
FT                   FWPGVNDYAYKVWKNFGERLEFNKIKDAVARGSRSTIALKRKARITSEKNEFANKSEWE
FT                   RTMYKAYKGLAVSYYANLSKFMSIPPMANIEFGQARYAMQAALDSSDPLRALQVIL"
XX
SQ   Sequence 4580 BP; 1295 A; 984 C; 1108 G; 1193 T; 0 other;

M28353  Length: 4580  December 21, 2001 15:55  Type: N  Check: 6704  ..

       1  gaaaaatttt taaattcata taactcccca tgctaagatt tgttactaaa
      51  aactctcaag ataaatcgtc tgatctattc tctatttgtt ctgatcgcgg
     101  aacttttgtt gctcataata gagttcggac tgatttcaag tttgacaact
     151  tagtatttaa ccgagtttat ggtgtttctc aaaaatttac gttagtcggt
     201  aacccgacag tctgctttaa tgaaggcagt tcttacctag aaggtattgc
     251  taaaaagtac ctaactttgg atggaggact tgccattgac aatgtcctca
     301  atgagttgag atccacttgc ggtatcccag gtaatgctgt tgcgtctcat
     351  gcgtataata ttacatcctg gcgttggtat gacaatcacg tggcactgtt
     401  gatgaacatg ttgcgtgctt accacttaca agtattgacc gaacagggcc
     451  aatatagcgc tggagatatc cctatgtacc atgatggaca tgtcaaaatc
     501  aagctaccag tgactatcga tgacacggca ggcccaacac aattcgcttg
     551  gcctagtgac aggtctactg attcgtatcc tgattgggca cagttttctg
     601  aatcatttcc atcaatcgac gtcccgtacc tagatgttag gccattgacc
     651  gtaacggaag tcaatttcgt gcttatgatg atgagtaagt ggcatagacg
     701  tactaactta gcgatagact acgaggcacc ccaactagct gataagttcg
     751  cttaccgcca tgcgcttact gttcaagacg ctgacgagtg gatagaaggc
     801  gatagaactg atgaccagtt ccgccccccc tcgtctaaag taatgttatc
     851  ggcacttcgt aagtacgtga accgtaacag gctgtacaat cagttttaca
     901  ctgcagcaca actgttagct caaattatga tgaaacctgt ccctaactgc
     951  gctgagggct acgcttggct gatgcatgac gcattggtca atataccaaa
    1001  atttgggtct attcgaggaa ggtacccttt tttgttatca ggtgatgcag
    1051  cgttgattca ggctacagcc ctagaagact ggtctgctat catggcgaaa
    1101  cccgagctgg tgttcactta cgcgatgcag gtgtcagtag cgttaaacac
    1151  cggactatac ttacgtcgcg ttaagaaaac aggcttcggc acaactatag
    1201  atgacagcta tgaagatgga gcgtttttgc aaccggagac gttcgttcag
    1251  gccgcactag catgttgtac cggacaagat gcgcccctaa atgggatgtc
    1301  agatgtgtat gtcacttatc cagatcttct agaatttgat gctgttacac
    1351  aagtacccat cacggtcatt gagcccgctg gctataacat tgttgatgat
    1401  catttagtgg ttgtgggtgt acctgtggca tgttcaccat acatgatatt
    1451  tccagtagct gcgtttgata ctgcaaatcc ttactgtggg aattttgtca
    1501  ttaaggctgc taacaagtat ctccgtaagg gtgccgtgta tgataaactc
    1551  gaagcatgga agttggcctg ggcactgagg gtagccgggt atgacactca
    1601  cttcaaagtg catggcgata cacacggctt aactaagttc tatgctgaca
    1651  acagtgacac atggacacac atacctgaat ttgtcactga cggtgacgtg
    1701  atggaagtat tcgttactgc catcgaacgc agagctagac atttcgttga
    1751  actacctaga ctgaattcac cagcattctt cagatctgta gaagtcagca
    1801  ccactatata tgatactcat gtgcaggctg gtgcgcattc agtgtatcat
    1851  gctagacgaa tcaatcttga ttatgttaag cctgtttcga ccggcattca
    1901  ggtgatcaat gcgggcgaac ttaagaacta ctggggtagt gtgcgtcgta
    1951  ctcagcaggg tttaggagtg gtaggtctta cgatgccagc tgtaatgcct
    2001  accggagaac ctacagctgg cgctgcccac gaagagttga tagaacaggc
    2051  ggacaatgtt ttagtagagt aaacgtaatc gaaccctcac acggaccccg
    2101  ccctacaagg tacatactgc aggaaccagg tacgtaccct gcgtggatta
    2151  gattcaggaa cagagtacaa gctgtatcgc gtcagaaagc cactcacttc
    2201  ttgtttgaca tcgtacctgc cgcagtaatt agtgatttta ctacgtctga
    2251  cacgtcttcg tttgcataca aatcgcacac ctacgctgca aatgtaacag
    2301  cattgaggtt cagtgacact tatgccttgt acgtacagac tgataccaat
    2351  atgacaattt taagcccagc ggcgcgtcgc caggcttctg cgacgtactc
    2401  acaggtggca gggttttgtt ataacacacc taccgttatg gattcgctag
    2451  cgaatatctt ggacgtagac cgcaatatac gacccaaaca cttcaagggt
    2501  ttacggctat acaccagctc taaggtcact gctcaacatc atactcactt
    2551  gcggccagac gagctagtgg aagcggccgc aaaggtctcg cctagacgta
    2601  aatactacct aatgtgtgta gttgagctgc tcgcgaactt acaagtagat
    2651  cttgaagcag cagtagctac tattctagca tatgtcctga cactaagtga
    2701  aaaatttgta ccaattttct tggattctag agcaatatgg gtcggtgagc
    2751  ctgggcctga tgctctgact gcacgtctca aggccagtag tgggcagatc
    2801  aagagcatac acacggctga ttacgaacca ctcactgaac tattcgagtt
    2851  agcagtattg atgaaccgag gtgttggcca tgtctcttgg caagctgaaa
    2901  aggatcatcg cttgaatccc gacgtggctg tagttgatca agcacggcta
    2951  tattcgtgtg tgcgcgacat gttcgaagga tcaaagcaga cgtataaata
    3001  tccctttatg acgtgggatg actacactgc aaacagatgg gagtgggttc
    3051  caggtggcag tgtccactct caatacgaag aagacaacga ttatatctat
    3101  cctggtcagt atactaggaa caagttcata actgttaaca aaatgcccaa
    3151  acacaaaata tctagaatga tagcatcacc gcctgaggta cgagcttgga
    3201  cgtcgacgaa gtacgaatgg ggcaagcaac gtgctatcta cgggacggat
    3251  ctacgaagta cactgataac taactttgca atgttcaggt gcgaggatgt
    3301  tctcactcac aagttcccag taggcgacca ggcagaggca gcaaaggtgc
    3351  acaaacgggt gaacatgatg ctggacggtg cctctagttt ctgcttcgat
    3401  tatgatgact tcaattctca gcattcgata gctagtatgt atacggtttt
    3451  gtgcgctttc agggacacat ttagtcgcaa catgtctgat gaacaagcag
    3501  aggcgatgaa ctgggtgtgt gagtccgtca gacacatgtg ggtactagat
    3551  cctgatacca aggagtggta cagactacaa ggtacattac tgtcaggatg
    3601  gcggttaacc acatttatga atactgtgct aaactgggcg tatatgaaat
    3651  tagctggcgt atttgatctg gatgacgttc aagactcggt acacaacggt
    3701  gatgatgtta tgattagtct caaccgcgtg agcacagcag tgagaataat
    3751  ggacgctatg caccggataa atgcgcgagc acagccggcg aagtgtaact
    3801  tgttttcgat aagtgaattt ctgagggtag aacacggtat gagcggaggc
    3851  gatggtcttg gggctcagta cttaagtagg tcttgtgcta ctcttgtaca
    3901  cagtaggatt gagtctaacg aaccactgtc agtagtacga gttatggaag
    3951  cagaccaggc tagattgcgc gacctggcaa acagaacgcg ggtacaatct
    4001  gcggtaacag cgataaaaga acaactcgac aaacgtgtca ctaagatatt
    4051  cggagttggt gatgacgttg tgcgcgacat acacacagct cacagggtgt
    4101  gtggcggtat ctcgactgat acctgggcac cggttgaaac taagataata
    4151  acagacaatg aagcatatga aataccatac gaaatagatg atccatcatt
    4201  ttggccaggg gtaaatgatt atgcttataa agtctggaaa aatttcggag
    4251  aacgactcga atttaataaa attaaagatg ccgtagctag agggagtagg
    4301  agcactatag ctctgaaacg taaggctagg ataacatctg agaagaatga
    4351  attcgctaac aagtcggaat gggaaaggac aatgtacaaa gcctataagg
    4401  gtttggcagt ctcatactat gctaacctga gcaaattcat gagtatacca
    4451  ccaatggcga acattgaatt tgggcaggct agatatgcta tgcaagcagc
    4501  ccttgatagt tctgatccac tccgggcatt acaggtcata ctgtagttgc
    4551  caaaaagata atgggaatta cccatatgca