Sequence of DPV Tobacco necrosis virus A

Tobacco necrosis virus RNA dependent RNA polymerase and coat protein genes, complete cds.

ACC No: M33002

Dated: 2005-04-17 | Length: 3684 | CRC: 1600981009

                !!NA_SEQUENCE 1.0
ID   TNCPOLY    standard; genomic RNA; VRL; 3684 BP.
XX
AC   M33002;
XX
SV   M33002.1
XX
DT   23-JUL-1990 (Rel. 24, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 10)
XX
DE   Tobacco necrosis virus RNA dependent RNA polymerase and coat protein genes,
DE   complete cds.
XX
KW   .
XX
OS   Tobacco necrosis virus A
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Necrovirus.
XX
RN   [1]
RP   1-3684
RX   MEDLINE; 90320143.
RX   PUBMED; 2371773.
RA   Meulewaeter F., Seurinck J., Van Emmelo J.;
RT   "Genome structure of tobacco necrosis virus strain A";
RL   Virology 177(2):699-709(1990).
XX
RN   [2]
RP   3661-3684
RA   Meulewaeter F.;
RT   ;
RL   Submitted (16-JAN-1996) to the EMBL/GenBank/DDBJ databases.
RL   Frank Meulewaeter, Plant Genetic Systems N.V., Gent, Belgium
XX
RN   [3]
RP   1-3660
RA   Meulewaeter F.;
RT   ;
RL   Submitted (20-MAR-1990) to the EMBL/GenBank/DDBJ databases.
RL   Frank Meulewaeter, Plant Genetic Systems N.V., Gent, Belgium
XX
CC   On Jan 31, 1996 this sequence version replaced gi:310914.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .3684
FT                   /db_xref="taxon:12055"
FT                   /mol_type="genomic RNA"
FT                   /organism="Tobacco necrosis virus A"
FT                   /isolate="TNV-A-FM1B"
FT                   /clone="pFM2[0,1,2,3]"
FT   CDS             60. .2234
FT                   /codon_start=1
FT                   /db_xref="GOA:P22958"
FT                   /db_xref="UniProt/Swiss-Prot:P22958"
FT                   /note="putative; readthrough stop codon"
FT                   /transl_except=(pos:666. .668,aa:OTHER)
FT                   /product="RNA-dependent RNA polymerase"
FT                   /protein_id="AAA86434.2"
FT                   /translation="MELPNQHKQTAAEGFVSFLNWLCNPWRRQRTVNAAVAFQKDLLAI
FT                   EDSEHLDDINECFEESAGAQSQRTKVVADGAYAPAKSNRTRRVRKQKKHKFVKYLVNEA
FT                   RAEFGLPKPTEANRLMVQHFLLRVCKDWGVVTAHVHGNVALALPLVFIPTEDDLLSRAL
FT                   MNTHATRAAVRGMDNVQGEGWWNNRLGIGGQVGLAFRSKXGCLERRPGFSTSVSRGEHP
FT                   DLVVIPSGRPEKQRQLLRYSGIGGHLLIGIHNNSLSNLRRGLMERVFYVEGPNGLQDAP
FT                   KPVKGAFRTLDKFRDLYTKNSWRHTPVTSEQFLMNYTGRKLTIYREAVDSLSHQPLSSR
FT                   DAKLKTFVKAEKLNLSKKPDPAPRVIQPRSPRYNVCLGRYLRHYEHHAFKTIAKCFGEI
FT                   TVFKGFTLEQQGEIMRSKWNKYVNPVAVGLDASRFDQHVSVEALEYEHEFYLRDYPNDK
FT                   QLKWLLKQQLCNVGTAFASDGIIKYKKKGCRMSGDMNTSLGNCILMCAMVYGLKEHLNI
FT                   NLSLANNGDDCVIVCEKADLKKLTSSIEPYFKQFGFKMEVEKPVDIFERIEFCQTQPVF
FT                   DGSQYIMVRKPSVVTSKDVTSLIPCQTKAQYAEWLQAVGECGMSINGGIPVMQNFYQKL
FT                   QTGIRRTKFTKTGEFQTNGLGYHSRYMHRVARVPSPETRLSFYLAFGITPDLQEALEIF
FT                   YDTHKLELDDVIPTDTYQVSGEHLINGLPN"
FT   CDS             2218. .2436
FT                   /codon_start=1
FT                   /db_xref="UniProt/Swiss-Prot:P22960"
FT                   /note="ORF 3"
FT                   /product="unknown"
FT                   /protein_id="AAA86435.1"
FT                   /translation="MDYQTDVTEDNVQIRGRARSVEGKKHNGSGLTGVKRHAVSETSQK
FT                   SQQGTGNGTMTNIAEEQTITVTYNFNF"
FT   CDS             2440. .2610
FT                   /codon_start=1
FT                   /db_xref="UniProt/Swiss-Prot:P22961"
FT                   /note="ORF 4"
FT                   /product="unknown"
FT                   /protein_id="AAA86436.1"
FT                   /translation="MAACRCCDTSPGITLFPYFAILILILAILVVGTPNQQYHHSPSTY
FT                   EYKTQHISIAK"
FT   CDS             2613. .3443
FT                   /codon_start=1
FT                   /db_xref="GOA:P22959"
FT                   /db_xref="HSSP:4SBV"
FT                   /db_xref="InterPro:IPR000937"
FT                   /db_xref="InterPro:IPR008975"
FT                   /db_xref="UniProt/Swiss-Prot:P22959"
FT                   /product="coat protein"
FT                   /protein_id="AAA86437.1"
FT                   /translation="MAGKKNNNNGQYIILRTPEQQVEIDQRNARRAQMGRMKKARQPVQ
FT                   RYLQQHGLRNGLSGRGGYIVAPTSGGVVTRPIVPKFSNRGDSTIVRNTEILNNQILAAL
FT                   GAFNTTNSALIAAAPSWLASIADLYSKYRWLSCEIIYIPKCPTTTSGSIAMAFTYDRND
FT                   AAPTARAQLSQSYKAINFPPYAGYDGAAYLNSNQGAGSAIAVQLDVTKLDKPWYPTISS
FT                   AGFGALSVLDQNQFCPASLVVASDGGPATATPAGDLFIKYVIEFIEPINPTMNV"
FT   CDS             3467. .3646
FT                   /codon_start=1
FT                   /db_xref="UniProt/Swiss-Prot:P22962"
FT                   /note="ORF 6"
FT                   /product="unknown"
FT                   /protein_id="AAA86438.1"
FT                   /translation="MPKVESHHWRRRRILGNRLDGRGVVPPTTHHSGYQWYTTMAGSAK
FT                   VLCTKNPWKRGGGG"
XX
SQ   Sequence 3684 BP; 1037 A; 900 C; 901 G; 846 T; 0 other;

   M33002  Length: 3684  May 10, 2005 10:09  Type: N  Check: 4315  ..

       1  agtattcata ccaagaatac caaataggtg caaggcctta ctcagctaaa
      51  gagtctaaaa tggagctacc aaaccaacac aagcaaacgg ccgccgaggg
     101  tttcgtatct ttcctaaact ggctatgcaa cccatggaga cgacagcgaa
     151  cagtcaacgc tgcagttgcg ttccaaaaag atcttctcgc cattgaggat
     201  tccgagcatt tggatgacat caatgagtgt ttcgaggagt ctgctggggc
     251  acaatctcag cgaactaagg ttgtcgccga cggagcatat gcccccgcaa
     301  aatccaacag gacccgccga gttcgtaagc agaagaagca caagtttgta
     351  aaatatcttg tcaacgaagc tcgtgccgag tttggattgc ccaaaccaac
     401  tgaggcaaac agacttatgg tccaacattt cttgctcaga gtgtgcaagg
     451  attggggcgt tgttactgcc cacgtacacg gcaatgttgc actagctttg
     501  ccactggtgt tcatcccaac ggaagatgat ctgctatcac gagcattgat
     551  gaacacacat gctactagag ccgctgtacg aggcatggac aatgtccaag
     601  gggaggggtg gtggaacaat aggttgggga ttgggggcca ggtcggactg
     651  gccttccggt ccaaataggg gtgccttgaa aggaggccag gattctccac
     701  gtccgtttcg cgtggggaac atcctgatct ggtggtcata ccatcagggc
     751  gccctgagaa acagcgtcag ttgttacgct atagtggtat aggcggccat
     801  ttattaatcg gcatccacaa caactctctt tccaacctgc gtaggggctt
     851  gatggaaaga gtattctatg tcgaggggcc caatgggctt caagacgccc
     901  ctaagcccgt caagggagct tttcgaaccc ttgataagtt tcgtgatctc
     951  tatactaaaa atagttggcg tcatacccct gtaactagtg aacaattcct
    1001  aatgaattac acgggcagga aactgactat ttacagagag gcggttgata
    1051  gtttgtcgca tcaacccctt agctcacgag atgcgaaact aaagacattc
    1101  gtgaaggccg aaaaattaaa tctttctaag aagcctgacc ctgctcccag
    1151  ggtcatccaa cctagatcgc ctcggtataa cgtttgtttg ggcaggtacc
    1201  tccgacatta tgagcatcac gcgtttaaaa ccattgccaa gtgctttggg
    1251  gaaatcacgg tcttcaaagg gtttactctg gagcaacaag gggaaatcat
    1301  gcgctcgaag tggaataaat atgttaatcc cgtcgcagtc ggactcgacg
    1351  ccagtcgttt cgaccaacac gtgtctgttg aagcactcga gtatgagcat
    1401  gaattttacc tcagagacta cccaaatgat aaacagctaa aatggctgct
    1451  aaagcagcaa ttgtgcaacg taggaacggc attcgccagt gacggcatta
    1501  taaaatacaa gaagaagggt tgtagaatga gcggagacat gaacacgagc
    1551  ttgggcaact gcattctaat gtgcgccatg gtctacgggt tgaaagaaca
    1601  cttaaacatc aatttgtccc ttgcaaataa tggggatgac tgcgtcattg
    1651  tctgtgagaa agcggattta aagaaattga caagcagcat cgagccatat
    1701  ttcaagcagt ttggattcaa gatggaagtg gaaaaacccg tggatatatt
    1751  tgagcgcata gaattttgcc aaacccaacc tgtgttcgat ggatcccagt
    1801  acatcatggt acgcaaacct tctgtggtaa catctaaaga cgtcactagc
    1851  cttatcccat gtcaaacgaa agcacaatac gcagaatggc tgcaagctgt
    1901  aggtgagtgt ggcatgagca ttaacggtgg gattcctgtc atgcagaatt
    1951  tctaccaaaa gctccaaact ggcatccgcc gcacaaaatt caccaagacc
    2001  ggcgagttcc agacgaacgg attggggtat cactctagat atatgcatag
    2051  agtggcccgg gttccttcgc ctgaaacccg tttatccttc tatctagctt
    2101  tcggtatcac accagacctc caagaagcat tggagatctt ctatgatacc
    2151  cacaagcttg agttggatga tgttatccca actgatacct accaagtgtc
    2201  aggagagcat ttgatcaatg gattaccaaa ctgatgtaac ggaggacaat
    2251  gtgcaaatac gcggtcgggc taggagcgtt gagggtaaga aacacaatgg
    2301  ttcgggatta actggcgtta agcgtcacgc ggtgagcgaa acatctcaga
    2351  aatcacagca aggtactggc aatggaacta tgaccaatat agccgaagaa
    2401  cagaccatta ccgtgacata caactttaac ttttaagtta tggctgcgtg
    2451  tcgctgttgt gatacttcac caggtattac actattccct tactttgcaa
    2501  ttctcatcct tatattggca atacttgttg tagggactcc caatcaacaa
    2551  tatcaccatt ctccaagcac ttacgagtac aagactcaac acatttcgat
    2601  cgcaaaatag acatggcagg aaagaagaac aacaacaacg gtcagtatat
    2651  aatactgcgt actccagagc aacaggtgga gatagaccag cgcaacgccc
    2701  gtcgtgctca aatgggtcgc atgaagaagg ctagacagcc cgttcagcga
    2751  tacttacagc aacacgggtt gcgaaacgga ttgtccggta gagggggcta
    2801  catagtggct cccacctccg ggggggttgt cactcgaccc atagtgccga
    2851  aattctccaa caggggagat tccactatag tccgtaacac tgagattttg
    2901  aacaaccaaa tcttagcggc gctaggcgca ttcaatacaa caaactccgc
    2951  actgattgca gcagcaccat catggctggc tagcatcgct gatctttaca
    3001  gtaaatacag atggctctca tgtgagatca tctacattcc aaaatgcccc
    3051  accaccacca gtggatcaat tgccatggct ttcacatacg acagaaatga
    3101  cgctgcaccc accgcaaggg ctcagctgtc acaatcttac aaggccatca
    3151  attttccacc gtatgcggga tacgacggag cagcatattt gaattcgaac
    3201  cagggagctg ggtcagccat cgccgttcaa cttgatgtta ccaagttgga
    3251  caagccatgg taccccacta tctcctctgc cggcttcggg gcgctcagcg
    3301  tcctcgatca gaaccaattc tgccccgcgt cccttgtggt cgctagcgat
    3351  gggggacccg ctactgctac tccagcaggg gaccttttca tcaagtacgt
    3401  gattgagttc attgaaccaa tcaacccaac aatgaacgtc tagttctttg
    3451  tactgtaact tggctaatgc ctaaggtgga gtcacaccat tggagacgga
    3501  gacggatcct gggaaacagg cttgacgggc ggggggtggt gcccccgacg
    3551  acgcatcact ccggatacca atggtacacc actatggcag ggtctgccaa
    3601  ggtcttgtgc accaagaacc cctggaaacg ggggggaggg gggtagcaca
    3651  tatcatccag attgaggggc ctttgcccca cccc