Sequence of DPV Beet yellows virus

Beet yellows virus coat protein gene, complete cds, and two ORFs.

ACC No: M59452

Dated: 2006-11-14 | Length: 2724 | CRC: -376559459

                
ID   M59452; SV 1; linear; genomic RNA; STD; VRL; 2724 BP.
XX
AC   M59452;
XX
DT   01-AUG-1991 (Rel. 28, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 4)
XX
DE   Beet yellows virus coat protein gene, complete cds, and two ORFs.
XX
KW   coat protein.
XX
OS   Beet yellows virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-2724
RA   Brunstedt J., Moseley J., Hull R.;
RT   "Nucleotide sequence of cDNA encoding the coat protein of beet yellows
RT   virus";
RL   Unpublished.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .2724
FT                   /organism="Beet yellows virus"
FT                   /isolate="Broom's barn"
FT                   /mol_type="genomic RNA"
FT                   /db_xref="taxon:12161"
FT   CDS             <1. .1287
FT                   /codon_start=1
FT                   /label=ORF_1
FT                   /db_xref="GOA:Q04366"
FT                   /db_xref="InterPro:IPR004909"
FT                   /db_xref="UniProtKB/TrEMBL:Q04366"
FT                   /protein_id="AAA72953.1"
FT                   /translation="PDFVRKLNGNLAEPSLVEHCWSLSNSCGELINPKDTKRFVSLIFK
FT                   GKDVVESTDEAVVSSSYLDYLSHCLNLYETCNLSSNSGKKALYDEFLKYVIAYLETSDL
FT                   EYRSPSDNPLVAGVLYDMCFEYNTLKSTYLKNIESFDCFLSLYLPLLSEIFSMNWEQPA
FT                   PDVRLLFELDTAELLLKIPTINTLDSTFLYKNKLRYLESYFEDDSNELIKVKVDSLLTR
FT                   DNPELKLAQRWVGFHCYYGVFRTAQTRKVKRDAEYKLPPALGEFTINMSGVEEFFDELQ
FT                   KKMPSVSVRRRFCGSLSHEAFSIFKRFGVGFPPITRLNVPVKYSYLNVDYYRHVKRAGL
FT                   TQDELTILSNIEFDVAEMCCEREVALQARRAQRGEKPFQGWKGVKNEVSPHARSSIRVK
FT                   KSNESLLNILWKDVGARRQGRLNPLHRKH"
FT   CDS             1235. .1885
FT                   /codon_start=1
FT                   /label=ORF_2
FT                   /db_xref="GOA:Q04369"
FT                   /db_xref="InterPro:IPR002679"
FT                   /db_xref="UniProtKB/TrEMBL:Q04369"
FT                   /protein_id="AAA72954.1"
FT                   /translation="MLAPEGRGDLIHFTENTRDAMETFFNSYDLAEYSEVNPNKLNRKE
FT                   TDELLGVIRERFKSELVITDEDFVKHLAFALIRAGNITTSTKVNYVGAYEYTIGGKKFL
FT                   VKDAWVFPLIKECMKKFNKPNPVRTFCATFEDAYIVIARSLPKLNLNRTIGKRGIPSGY
FT                   EFLGADFLTATSVCLNDHEKAIVLQASRAAIDRAVSSSVDGKIVSLFDLGRLS"
FT   CDS             1956. .2570
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /label=ORF_3
FT                   /db_xref="GOA:Q03724"
FT                   /db_xref="InterPro:IPR002679"
FT                   /db_xref="UniProtKB/TrEMBL:Q03724"
FT                   /protein_id="AAA72955.1"
FT                   /translation="MGSAEPISAIATFENVSLADQTCLHGEDCDKLRKNFEECLKLKGV
FT                   PEDKLGLALGLCLYSCATIGTSNKVSVQPTSTFIKASFGGGKELFLTHGELRSFLDSQK
FT                   LLEGKPNKLRCFCRTFQKDYISFAKEYRGRLPPIARANRHGLPAEDHYLAADFISTSTE
FT                   LTDLQQGRLLLARENATHTEFSSESPVTSLKQLGRGLATGR"
XX
SQ   Sequence 2724 BP; 739 A; 591 C; 638 G; 756 T; 0 other;

m59452 Length: 2724  14-NOV-2006  Type: N  Check: 4093  ..

       1  ccagatttcg tgagaaagct caacgggaat ctggccgaac cttctctcgt
      51  cgagcactgt tggtctctgt ctaattcttg cggcgaactg atcaatccga
     101  aagacacgaa gcggttcgtt tctctcatct ttaaggggaa ggacgtcgtc
     151  gaaagcaccg acgaagccgt agtttcctct tcttacttag attacctttc
     201  acactgtttg aacttgtacg aaacgtgtaa tctttcgtct aactcgggga
     251  agaaagctct gtacgatgaa tttctaaagt acgtgatcgc ttatcttgag
     301  actagcgact tagagtaccg ttcaccttcc gacaaccctt tggttgctgg
     351  tgttctttac gatatgtgtt ttgaatataa cacgctcaag tcgacgtacc
     401  taaagaacat agagtcgttc gactgttttt tgagtctgta cttaccgttg
     451  ctcagtgaaa tcttttcgat gaactgggaa caaccagcgc ctgacgtccg
     501  gttgcttttc gaactcgata cagccgaact tcttttgaaa attccgacta
     551  tcaacacgct cgactcaacc tttttgtata agaataagtt gaggtacctg
     601  gaatcctact ttgaagacga ctctaatgag ctcataaagg tgaaagttga
     651  ttcactctta acccgagaca atcctgaact gaaactagct cagagatggg
     701  taggtttcca ttgttactac ggggttttta ggaccgctca gactaggaaa
     751  gtgaaaagag atgcggaata caaactgcct ccggctctcg gtgaattcac
     801  aataaacatg agtggagtgg aagaattctt tgatgagctg cagaagaaaa
     851  tgccttctgt ttctgttcgt cgcagatttt gtggcagttt gtctcacgaa
     901  gctttttcca ttttcaagag attcggggtg ggtttccctc cgatcaccag
     951  attaaacgtt cccgtgaagt actcctatct aaacgttgat tattacagac
    1001  acgtgaagag agcgggcttg acgcaggacg agttgactat tctcagtaac
    1051  atcgaattcg acgtcgctga aatgtgctgc gagagggaag tggctttaca
    1101  agcccgtcgc gctcagcgcg gcgaaaaacc atttcagggt tggaaaggtg
    1151  ttaaaaacga agtttctccg cacgcgcgtt cctcaattcg agtgaaaaag
    1201  agcaacgaat cgttactaaa cattttgtgg aaagatgttg gcgcccgaag
    1251  gcaggggaga cttaatccac ttcaccgaaa acactagaga tgccatggaa
    1301  actttcttca acagctacga tttagctgaa tactccgaag tgaaccctaa
    1351  caaactcaat cggaaagaga ccgacgagtt gttaggtgtt attcgagaga
    1401  gatttaaatc cgaattggtg ataacagatg aagattttgt gaaacattta
    1451  gccttcgcgt tgattcgcgc cggcaatatc accactagta cgaaagtcaa
    1501  ctacgtcgga gcgtacgagt atacgatagg gggaaagaag ttcctggtta
    1551  aggacgcttg ggttttccct ttaataaagg agtgtatgaa aaagttcaac
    1601  aaacccaatc ctgtgaggac gttttgtgcc actttcgaag acgcttacat
    1651  agtgatagct cgttcgttgc ccaaactgaa cctgaataga accattggca
    1701  aacgtgggat cccgtcaggg tatgagttcc tcggggcgga ttttctaact
    1751  gcgaccagcg tgtgtttgaa cgatcacgaa aaagctatcg tactacaggc
    1801  ttcaagagct gccattgata gagcagtctc ttcgtcggtc gacgggaaga
    1851  tcgtcagtct tttcgacctc ggtcgtctta gttaacacag ttactaaggt
    1901  tccattttat tatcgtattg tttttcattt agtgtaatcg tacttgagtt
    1951  ctgacatggg atcagccgaa cctataagtg caatcgcgac ttttgaaaac
    2001  gtgagtctcg cagaccaaac gtgtttgcac ggtgaagact gcgacaaact
    2051  acggaagaat ttcgaagagt gtttgaaatt gaaaggggtt ccggaagaca
    2101  aactcggtct cgcgttagga ctttgtttgt attcctgtgc gacgataggt
    2151  acttctaata aagttagtgt ccaaccgacg tctactttca tcaaagcttc
    2201  gttcggtggt gggaaggaat tgttcctcac tcacggtgaa ctgaggtctt
    2251  ttctggactc tcagaaactt ttggaaggaa agcctaacaa gttgcgttgt
    2301  ttctgccgca cttttcagaa ggactacata tccttcgcga aggaataccg
    2351  aggaagactg cctccgattg ctagagccaa ccgtcacggt ctacctgctg
    2401  aagatcacta cttagctgct gatttcatat cgacatcaac agaacttact
    2451  gacctacaac aaggtcgtct gctgttggcg cgcgaaaacg ccactcacac
    2501  agagttctcg tctgaatcac cagtaactag tttgaaacag ctgggtcgtg
    2551  gtctagccac cggaagatga ttggctctgt cgaactagct cagacgagac
    2601  ccttttttag agtattactg ttaaagggtt tcgtttatta tattgttgca
    2651  atcgaaacag aagaagaacc atctgaagct gaacttcctt tggtttacct
    2701  ccacgatctc gagttgaatg ttaa