Sequence of DPV Citrus tristeza virus

Citrus tristeza virus coat protein gene, complete cds.

ACC No: M76485

Dated: 2000-03-04 | Length: 1080 | CRC: -366323456

                !!NA_SEQUENCE 1.0
ID   CTVCOAT    standard; RNA; VRL; 1080 BP.
XX
AC   M76485;
XX
SV   M76485.1
XX
DT   01-JUL-1992 (Rel. 32, Created)
DT   04-MAR-2000 (Rel. 63, Last updated, Version 2)
XX
DE   Citrus tristeza virus coat protein gene, complete cds.
XX
KW   coat protein.
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-1080
RX   MEDLINE; 91237334.
RA   Sekiya M.E., Lawrence S.D., McCaffery M., Cline K.;
RT   "Molecular cloning and nucleotide sequencing of the coat protein of citrus
RT   tristeza virus";
RL   J. Gen. Virol. 72:1013-1020(1991).
XX
DR   SWISS-PROT; Q00686; COAT_CTV36.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1080
FT                   /db_xref="taxon:12162"
FT                   /organism="Citrus tristeza virus"
FT                   /cell_line="E. coli DH5-alpha and XL1-blue"
FT                   /tissue_lib="pBluescript"
FT   misc_difference 80
FT                   /note="puplished in J. Gen. Virol. 72 1013-1020 (1991) as
FT                   an `A'"
FT   CDS             178. .849
FT                   /codon_start=1
FT                   /db_xref="SWISS-PROT:Q00686"
FT                   /product="coat protein"
FT                   /protein_id="AAA42924.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVVAAESSFSSVNLHIDPTLITMNDV
FT                   RQLSTQQNAALNRDLFLTLKGKHPNLPDKDKDFRIAMMLYRLAVKSSSLQSDDDATGIT
FT                   YTREGVEVDLSDKLWTDVVFNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADDVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 1080 BP; 294 A; 193 C; 272 G; 321 T; 0 other;

M76485  Length: 1080  December 21, 2001 15:56  Type: N  Check: 5344  ..

       1  ccgagtctat gttagctaga cgtcaaggtt acgaggaggc gaccgagctt
      51  cttaacctac gcgatttggg taagtacttg tagttggttt ggggacggta
     101  acattatact atcccatgaa gcgctgcctt aagggtcgtt aattgacgac
     151  ttttgatata tttactaggt ttgaattatg gacgacgaaa caaagaaatt
     201  gaagaacaaa aacaaggaaa caaaagaagg cgacgatgtt gttgctgccg
     251  agtcttcttt cagttccgta aacttacaca tcgatccgac tttgataacg
     301  atgaacgatg tgcgtcagtt gagtacccaa cagaacgctg ctttgaacag
     351  agacttattc cttactttga aagggaagca tcctaactta cctgataaag
     401  ataaggactt tcgcatagct atgatgttgt atcgtttagc agttaagagt
     451  tcatcattac aaagcgatga cgacgccacg ggtataacgt acactcggga
     501  gggtgttgaa gtggatttgt ctgacaaact ttggactgac gtcgtgttta
     551  actctaaggg tattggtaac cgtactaacg cccttcgagt ttggggtaga
     601  actaacgatg ccctttactt agctttttgc agacagaatc gcaatttgag
     651  ttatggcgga cgtccgctag acgcagggat tccggccggg tatcattact
     701  tgtgtgcgga tttcttgact ggggctggtt tgactgattt agaatgtgct
     751  gtgtacatac aagctaaaga acaattattg aagaagcgag gggctgatga
     801  tgtcgtagtt actaatgtca ggcagcttgg gaaattcaac acacgttgat
     851  ctgttgcgtt ccgattcccg gtttctatcg ggatggtgga gtttcatcgt
     901  gaacgtgggt gatataatcg tccggttcgc gttacacgtt cctaatgaag
     951  atatgctgaa tagtttttca gctatatcga attgtacgat tatagcggac
    1001  ggtagtgctt tactaaaaga taatactgtg ggtcgatcgt ttagaaggca
    1051  tgaatccttt ggcttattta ttaaaattag