Sequence of DPV Carnation ringspot virus

Carnation ringspot virus CRSV movement protein mRNA, complete cds.

ACC No: M88589

Dated: 1999-03-15 | Length: 1403 | CRC: -348687560

                !!NA_SEQUENCE 1.0
ID   CIRCRSV    standard; RNA; VRL; 1403 BP.
XX
AC   M88589;
XX
SV   M88589.2
XX
DT   30-MAR-1992 (Rel. 31, Created)
DT   15-MAR-1999 (Rel. 59, Last updated, Version 5)
XX
DE   Carnation ringspot virus CRSV movement protein mRNA, complete cds.
XX
KW   .
XX
OS   Carnation ringspot virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Dianthovirus.
XX
RN   [1]
RP   1-1403
RX   MEDLINE; 93019078.
RA   Kendall T.L., Lommel S.A.;
RT   "Nucleotide sequence of carnation ringspot dianthovirus RNA-2";
RL   J. Gen. Virol. 73:2479-2482(1992).
XX
RN   [2]
RP   1-1403
RA   Lommel S.A.;
RT   ;
RL   Submitted (02-AUG-1993) to the EMBL/GenBank/DDBJ databases.
RL   Plant Pathology, North Carolina State University, Box 7616, Raleigh, NC
RL   27695, USA
XX
RN   [3]
RC   Sequence update by submitter
RP   1-1403
RA   Sit T.L., Lommel S.A.;
RT   ;
RL   Submitted (11-MAR-1999) to the EMBL/GenBank/DDBJ databases.
RL   Plant Pathology, North Carolina State University, Box 7616, Raleigh, NC
RL   27695, USA
XX
DR   SPTREMBL; Q66095; Q66095.
XX
CC   On Mar 11, 1999 this sequence version replaced gi:323333.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1403
FT                   /db_xref="taxon:12268"
FT                   /organism="Carnation ringspot virus"
FT   5'UTR           1. .46
FT                   /gene="CRSV movement protein"
FT   CDS             47. .961
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:Q66095"
FT                   /gene="CRSV movement protein"
FT                   /product="CRSV movement protein"
FT                   /protein_id="AAA42901.1"
FT                   /translation="MAVHVDNVKDLAKTNEGVSVILNRYTDWKCKSGVTEAPLLPSNLG
FT                   TRITDYAKTTLKGDSVALNFSDLVLSLGATVSVGTPGSVLVELINPNMDGPFQLVQGQS
FT                   LSWSPGSGRPCLMIFSIHHQLTADAEPFRIRISNNGIPTKKTFARCHAYWGFDLSPRMR
FT                   YYKNEPAKRIDLDVGFYKTHLSNMKQVRDYVQYTFDNSRMDGNPQLVAKSTMNVVPRIA
FT                   DVPKYVGIAPPSRSGNHQEATPDDWLKQYVDKDSETNKLSDVESSSDSSSLLSMRARSR
FT                   RYTKNYKIPIKRHPQATGEVGTT"
FT   3'UTR           962. .1394
FT                   /gene="CRSV movement protein"
XX
SQ   Sequence 1403 BP; 380 A; 318 C; 340 G; 364 T; 1 other;

M88589  Length: 1403  December 21, 2001 15:56  Type: N  Check: 4154  ..

       1  acaaatcttt accacaacga atcgattaca agattaagga tttgagatgg
      51  cagttcatgt agataacgtt aaagacttag ccaagactaa cgaaggggtc
     101  tcagtaattc tgaacagata caccgactgg aaatgcaaat ctggagtgac
     151  tgaagcacca ctcttgccga gcaatctagg aaccagaatc actgattatg
     201  ccaagaccac gctgaaaggt gacagtgttg cactgaactt ttcggactta
     251  gttctttcgt tgggtgccac agtttctgtc ggcactcctg gtagtgtact
     301  agtcgaattg atcaatccaa atatggatgg gccttttcag ttggtacaag
     351  ggcaatcgct ctcttggagt ccaggctctg ggaggccctg tcttatgata
     401  ttttccatcc atcatcaatt gacagcagat gcagaacctt ttcggatccg
     451  gatttccaat aacggtatcc ccacgaagaa aaccttcgca aggtgtcatg
     501  catactgggg atttgacttg agtcctcgaa tgaggtacta caagaatgaa
     551  ccagctaaac gaattgattt ggatgtaggg ttttataaga ctcacctttc
     601  gaatatgaaa caagtcagag attacgtaca gtataccttt gataacagca
     651  ggatggacgg gaatcctcag ctggtggcca agtcgaccat gaatgtcgtc
     701  ccacgtattg ccgatgtgcc caagtatgtc ggtatcgccc cgccttcgcg
     751  ctcgggaaat catcaggagg ctacgcctga tgactggctg aagcaatacg
     801  tggacaagga tagtgaaact aataagctat ctgatgttga gtcctcgtca
     851  gactctagtt cgctcttgag tatgagagca agatcccgaa gatatactaa
     901  gaactacaaa attccgatta aacgtcaccc gcaggcaacg ggtgaggttg
     951  gtacaactta atacggttgc cttcttgtgt tccataccac ggttctggtt
    1001  gctgaaatag tgcgcgccag gtaaaaacac actcgacaac tgtattaatt
    1051  tctatcaact gaaaatgcca ttgttaatcg tcaatgtacc acacccacat
    1101  tcacggcgtc atagccggcg aagtgcccga aagngtgcct caagttctcc
    1151  ttgggggtct ggtaggtgtg ggtttccttg gtgtgcaaca atggtatcta
    1201  cagcgtgtgg atcattgttt cttctttcca gcagcggcag gcgattgtgc
    1251  gcactggttc ggttatctga ggttttccag agttaggact ctggggtgag
    1301  agcagctaaa ctcactttaa taaaacaggg aaccgcggtg tctggtcacg
    1351  gccaggtcaa cacaccagtt aagataccca gatggtatat cccctgggcc
    1401  cct