Sequence of DPV Sweet clover necrotic mosaic virus

SC38P2=36.5 kda protein [sweet clover necrotic mosaic virus SCNMV, strain 38, Genomic RNA Complete, 1446 nt].

ACC No: S46027

Dated: 2004-09-01 | Length: 1446 | CRC: 2108060886

                !!NA_SEQUENCE 1.0
ID   S46027     standard; genomic RNA; VRL; 1446 BP.
XX
AC   S46027;
XX
SV   S46027.1
XX
DT   16-FEB-1993 (Rel. 34, Created)
DT   01-SEP-2004 (Rel. 81, Last updated, Version 4)
XX
DE   SC38P2=36.5 kda protein [sweet clover necrotic mosaic virus SCNMV, strain
DE   38, Genomic RNA Complete, 1446 nt].
XX
KW   .
XX
OS   Sweet clover necrotic mosaic virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Dianthovirus.
XX
RN   [1]
RC   GenBank staff at the National Library of Medicine created this entry [NCBI
RC   gibbsq 115546] from the original journal article.
RP   1-1446
RX   MEDLINE; 93019079.
RX   PUBMED; 1402823.
RA   Ge Z., Hiruki C., Roy K.L.;
RT   "A comparative study of the RNA-2 nucleotide sequences of two sweet clover
RT   necrotic mosaic virus strains";
RL   J. Gen. Virol. 73(Pt 9):2483-2486(1992).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1446
FT                   /db_xref="taxon:28348"
FT                   /mol_type="genomic RNA"
FT                   /organism="Sweet clover necrotic mosaic virus"
FT                   /strain="38"
FT   gene            78. .1058
FT                   /gene="SC38P2"
FT   CDS             78. .1058
FT                   /codon_start=1
FT                   /db_xref="UniProt/TrEMBL:Q90058"
FT                   /note="36.5 kda protein"
FT                   /product="SC38P2"
FT                   /gene="SC38P2"
FT                   /protein_id="AAB23554.1"
FT                   /translation="MAVHVESVNDLAKTNDGVAVLLNRYTDWKCRSGVTEAPLIPASIM
FT                   SKITDYARTTAKGNSVALNYTHVILSLAPTIGVAIPGHVTVELVNPNVDGPFQVMNGQT
FT                   LSWSPGAGKPCLMIFSVHHQLNSDHEPFRVRITNSGIPTKKSYARCHAYWGYDVGTRHR
FT                   YYKSEPARLIELEVGYQRTLLSSIKAVEAYVQFTFDTSRMESNPQLCTKSKVNIVPPKA
FT                   ETFPIRGIAPPLSVGKNQGQQSEVSKQQGGNGNESIKLSSSGPTLRPGSALSMKRGSRR
FT                   NIAYTSNPIKRNQDGNWLGDHLSNKGRDIRPKAGETLDEPVKLDA"
XX
SQ   Sequence 1446 BP; 413 A; 329 C; 364 G; 340 T; 0 other;

S46027  Length: 1446  September 7, 2004 08:32  Type: N  Check: 3656  ..

       1  aaacctcgat cataaagact aattgattcc aagcaagcaa agactgtaag
      51  actacgaaca atataggaag gtttgagatg gctgttcacg tggaaagcgt
     101  aaatgatttg gctaagacaa atgacggagt agcggtgcta ttgaaccgtt
     151  atactgattg gaaatgcagg tccggagtga cggaagctcc tctcatacct
     201  gccagtataa tgagtaagat aaccgactat gccaggacaa ctgccaaagg
     251  taatagtgtc gcgcttaatt acacccacgt aatcctttca ttagcaccta
     301  caattggtgt ggcaatccca ggacacgtta ccgtagaact ggtaaaccca
     351  aacgtggatg gaccttttca agttatgaat gggcagacct tgtcatggtc
     401  gccaggagca ggaaaaccct gcctcatgat cttctcagtc caccaccaac
     451  tcaactcgga tcacgagcct tttagggtgc gtatcactaa ttccggaata
     501  cctaccaaga agtcgtatgc aagatgccat gcgtactggg ggtacgacgt
     551  gggtacgaga caccgctatt acaagtcaga accagcgcgt ctgattgagt
     601  tggaagtagg ttaccaacgg acgttactgt cgagcatcaa agcagtggaa
     651  gcttacgtgc aatttacctt tgacacaagc aggatggaga gcaatcctca
     701  attgtgtacc aaatctaagg tgaacatcgt ccctcccaaa gcagagacgt
     751  ttccaatcag aggtatcgcc ccgcctctca gtgttgggaa gaatcaagga
     801  caacagtccg aggtgtcgaa gcagcaagga ggtaatggca acgaatccat
     851  taagttgtca tcgtcgggac ccactctcag gcccggttcc gctttgagta
     901  tgaagcgggg atctcgcagg aatattgcgt acacatctaa tccgattaaa
     951  cgtaaccaag atggcaattg gttaggtgat cacctttcta ataagggccg
    1001  ggatatccga cccaaagctg gagagactct agacgagcca gtgaaattag
    1051  acgcgtgacc actgaaaatg tcaaatccta ttcgaagtac agaaggagac
    1101  aagaattgcg ttggcttcgg cgagcgacga aatggtttaa atacaggcta
    1151  cgagttctcc tcgtagggtc tcttgcctcc ggccttaagt gggcttttga
    1201  tagggttttc atctacagcg tatggaccat ggatgttctg cggctgggca
    1251  tggtgtttgc gatagcatct tgtcccaggt tgatttcttt gcgattatgg
    1301  aggggttgga ctctcctggt gtgagaagaa aacacatcaa aacaaaaaac
    1351  agggttctgt aaccggtgcg acaatatgcc cttccaaggc actgaccggc
    1401  acggataaaa ctttatttgc ctagtcgtat aacggctagg cacccc