Sequence of DPV Sweet clover necrotic mosaic virus

SC59P2=36.5 kda protein [sweet clover necrotic mosaic virus SCNMV, strain 59, Genomic RNA Complete, 1449 nt].

ACC No: S46028

Dated: 2004-09-01 | Length: 1449 | CRC: 1454726075

                !!NA_SEQUENCE 1.0
ID   S46028     standard; genomic RNA; VRL; 1449 BP.
XX
AC   S46028;
XX
SV   S46028.1
XX
DT   16-FEB-1993 (Rel. 34, Created)
DT   01-SEP-2004 (Rel. 81, Last updated, Version 4)
XX
DE   SC59P2=36.5 kda protein [sweet clover necrotic mosaic virus SCNMV, strain
DE   59, Genomic RNA Complete, 1449 nt].
XX
KW   .
XX
OS   Sweet clover necrotic mosaic virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Dianthovirus.
XX
RN   [1]
RC   GenBank staff at the National Library of Medicine created this entry [NCBI
RC   gibbsq 115547] from the original journal article.
RP   1-1449
RX   MEDLINE; 93019079.
RX   PUBMED; 1402823.
RA   Ge Z., Hiruki C., Roy K.L.;
RT   "A comparative study of the RNA-2 nucleotide sequences of two sweet clover
RT   necrotic mosaic virus strains";
RL   J. Gen. Virol. 73(Pt 9):2483-2486(1992).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1449
FT                   /db_xref="taxon:28348"
FT                   /mol_type="genomic RNA"
FT                   /organism="Sweet clover necrotic mosaic virus"
FT                   /strain="59"
FT   gene            79. .1059
FT                   /gene="SC59P2"
FT   CDS             79. .1059
FT                   /codon_start=1
FT                   /db_xref="GOA:Q90059"
FT                   /db_xref="UniProt/TrEMBL:Q90059"
FT                   /note="36.5 kda protein"
FT                   /product="SC59P2"
FT                   /gene="SC59P2"
FT                   /protein_id="AAB23555.1"
FT                   /translation="MAVQVENVQDLAKTNKGEEVLKNRYTDWKCRSGVTEAPLIPASIM
FT                   SKITDYAKTTAKGNSVALNYTHVILSLAPTIGVAIPGHVTVELVNPNVDGPFQVMSGQT
FT                   LSWSPGAGRPCLMIFSVHHQLNSDHEPFRVRITNSGIPTKKSYARCHAYWGYDVGTRHR
FT                   YYKSEPARLIELEVGYQRTLLSSIKAVEAYVQFTFDTSRMESNPQLCTKSKVNIVPPKV
FT                   ETHPIRGIAPPLSVGKSQRRKSEVSKPKGGNDNETTKLSASGPSLRPGSALSMKQGSRR
FT                   NTAYTSTPIKRNQDDNWLGDHLSNKGRDIRPKAGETLDEPVKLDA"
XX
SQ   Sequence 1449 BP; 429 A; 336 C; 359 G; 325 T; 0 other;

 S46028  Length: 1449  September 7, 2004 08:32  Type: N  Check: 328  ..

       1  aaatctcgct cttcaaagac taattgaatc caagcaagca aagactgtaa
      51  gactacgatc aacatagaga gatttgagat ggctgttcaa gtggaaaacg
     101  tacaggattt ggccaagaca aataaaggag aagaggtcct taagaaccgt
     151  tatactgatt ggaaatgcag gtctggagtg actgaagctc ctctcatacc
     201  tgccagtata atgagtaaaa taaccgacta tgccaagaca actgccaaag
     251  gcaacagtgt tgcgcttaat tatacacacg taatcctttc actagcacca
     301  acaattggtg tggcaattcc aggacacgtt accgtagaac tggtaaaccc
     351  aaacgtggat ggaccctttc aagtcatgag cggacagacc ttgtcatggt
     401  cgccgggagc aggaagaccc tgcctcatga tattttcagt ccaccaccaa
     451  ctcaactcgg atcacgagcc ttttagggtg cgtatcacta attccggaat
     501  acctaccaaa aaatcgtatg caagatgtca tgcgtactgg gggtacgacg
     551  tgggtacgag acaccgctat tacaagtcag aaccagcgcg tctgattgag
     601  ttggaagtag gttaccaacg gacgttactg tcgagcatca aggcagtgga
     651  agcatacgtt cagtttacct ttgacacaag caggatggag agcaatcctc
     701  aattgtgcac caaatccaaa gtgaacatcg tccctcctaa ggtagagaca
     751  cacccaatca gaggtatcgc cccgcctctc agtgttggga aaagccaaag
     801  acgcaagtcc gaggtgtcaa agccgaaagg aggaaatgac aacgagacca
     851  caaagttgtc agcgtcggga ccgtctctca ggcccggttc tgctttgagt
     901  atgaagcagg gatctcgcag gaatactgcg tacacatcta ctccgattaa
     951  acgtaaccag gatgacaact ggttaggtga tcacctttct aataagggcc
    1001  gggatatccg acccaaagct ggagagactc tagacgagcc agtgaaatta
    1051  gacgcgtgac cactgaaaat gtcaaatcct attcgaagta cagaaggaga
    1101  caagaattgc gttggcttcg gcgagcgacg aaaaggttta agtacaggct
    1151  acgagttctc ctcgtagggt ctcttgcctc cggccttaag tgggcttttg
    1201  atagggtttc tcatctacag cgtatggacc atggatgttc tacggctaga
    1251  cagggtgttt gcgatagcat cctgttctag gttggtttct tagcgattat
    1301  ggaggggttg gaccctcctg gtgtgagaag gaaacacatc aaaacaaaaa
    1351  acagggttct gtaaccggtg cgacaatatg cccttccaag gcactgaccg
    1401  gcacggataa aactttattt gcctagtcgt ataacggcta ggcaccccc