Sequence of DPV Ustilago maydis virus H1

Ustilago maydis virus UmVH1 cap-pol fusion protein gene, complete cds.

ACC No: U01059

Dated: 2000-03-04 | Length: 6099 | CRC: 1400071109

                !!NA_SEQUENCE 1.0
ID   UMU01059   standard; RNA; VRL; 6099 BP.
XX
AC   U01059;
XX
SV   U01059.1
XX
DT   04-JAN-1995 (Rel. 42, Created)
DT   04-MAR-2000 (Rel. 63, Last updated, Version 4)
XX
DE   Ustilago maydis virus UmVH1 cap-pol fusion protein gene, complete cds.
XX
KW   .
XX
OS   Ustilago maydis virus H1
OC   Viruses; dsRNA viruses; Totiviridae.
XX
RN   [1]
RP   1-6099
RX   MEDLINE; 94111988.
RA   Bruenn J.A.;
RT   "A closely related group of RNA-dependent RNA polymerases from
RT   double-stranded RNA viruses";
RL   Nucleic Acids Res. 21(24):5667-5669(1993).
XX
RN   [2]
RP   1-6099
RA   Bruenn J.A.;
RT   ;
RL   Submitted (25-AUG-1993) to the EMBL/GenBank/DDBJ databases.
RL   Jeremy A Bruenn, Biological Sciences, State University of New York, at
RL   Buffalo, Buffalo, New York, 12260, USA
XX
DR   SPTREMBL; Q90153; Q90153.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .6099
FT                   /db_xref="taxon:28882"
FT                   /organism="Ustilago maydis virus H1"
FT                   /strain="P1H1"
FT                   /specific_host="Ustialgo maydis"
FT   CDS             540. .6002
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:Q90153"
FT                   /product="cap-pol fusion protein"
FT                   /protein_id="AAA81884.1"
FT                   /translation="MEQAAIPLNQGSNTAMSEDIGLAANILPVEQDDQASDSASVADQN
FT                   NLIENNLLPDELEAQKIRKTLENDKKPENVKKEKTTGEFTDVVQSAGLMADRVQEVVDV
FT                   ATWAKDVAIWAEFNAFDRNASATRQDPIKTSAIDWLLNQAPTHQLDSTSANPPTWVPVG
FT                   WGGKPNYALTISRRILIAIDAAEGARHDVYVTDSANLGIAWPDIGHPDSPYAPSEVRGR
FT                   PSMKHYNAAVSPQIISKITQTLDPTTAKFWQTSLQLKNETDAMWILRYRAKGAQVGDNH
FT                   LPLLVAAWQYYFDACRAHAAGLVCSKLGQRTAGYAYNIYKDTNWISSVAEQGKEIVNCI
FT                   GMPQDYATFWAMCCLPTQEIFAARTDALGTLYKTPFGAWRRRMRTEMCVISEHTVTYPS
FT                   TAPNWWTNPNLILGFMEMYSMKFGLDDQMNDALYVALLIPLMTVVGTPITLPEPVHSKD
FT                   WFEGLVELGQGLDAVRQLHLSSPTATTAAWSTSQSVMIGILGEVAEAELAQREGVAISQ
FT                   NTAANVIRTVAMALSRPGSFTATILCKLMHFPSTAIELAGLQTSFVPAGSLVPPPLWNY
FT                   RRLALWQHNLVPIRASRSYLSHGPNFNRLWKPEGTLTPAHFVTTVNELQVLRRYRILDV
FT                   VVSGQSELIPFDIVWTASTGRVTIPAMDPALREKIALVKKYGVKLYDVGSAGVGYLDQP
FT                   ERDPAEAVELYNSWQYMGITPSVAGSDVQYGGFVYDRPQTGGLPDDLNGPQAYSITSAI
FT                   DAAEAAGMMKRQAIFRKLATFGARGEIRTSQGNSSALLPVNSATTEERRDLSENCGWQG
FT                   LVKLGVGYPTVQALKRAVAGRLGNDPMWTASLPDKLSLDELSVIAGVLKIDLMLVECRL
FT                   PDQVVTCVVGDPDYKRVLYLADDHWDTHPSRQLLHAATSATSNRSEAVAKPTVEISDKT
FT                   RAVIYEQAIEKYNVNSLTKQGLLETHADLFPHREPPRSLLAAAPRANSPAESLGAGACE
FT                   CGCARIASKATQACDQILELMAMETAFPHRNATTSKKNNLQVKDICKIIIQKLKNPKTM
FT                   KPNARFGCAAAWLLRSQGQAAEFVTSVAAWVVSNRIGPAAWKWLWVGKGLYQTNEDDWV
FT                   AKAKSIHDDLRKHGYPPHVQATEEDWSQSLYLQALYGRGGVLVNWAEDFANKASHPDPI
FT                   QAWDGRCYSQKLATEIINETVNSVVETAYPKAVPQSFDRFMDNAYEWLVSGSSAGIPSP
FT                   LKNSPMRDLVLKEYGLSPRPTKRSVMEAIPRDKVLKILTETSPKIVAKAHMKLNETGGK
FT                   ARAIYGVTLWHYIFSNWLMAPVEKHLNHRSVDINLDGSAMLTATLHRLGQVEANMVFNS
FT                   YDYPDFNSMHTYEHMASIYRAAKRCAIKELRQRRGAQVSDQDLALIEHGFDWLIESVYH
FT                   QYVIHPDTGAIIKTASGLYSGDRDTTLINTLLNIAYASVTDRSMAHKYVDPGVVERLCH
FT                   GDDIITVHRSLPGAMLWNDEAAKCNLKGQESKLMIDHKHHEYLRIMGCDDVKLRGCLAR
FT                   CVATYVNGNWETERVVGVWAKLQEAASSLATWIRRGASQEIVQELWYISRYRMLTETYR
FT                   FTPTDAKSLNIRDSPQSSNTATLSYEQLPANVTSPYIKKLVAELPHDLRPTSKELGQLR
FT                   RVLQKSTYGTELPLTYQQTDLTKISDGAIETVRTLGGAAGRVFNSPDYHKLKLEGTAKS
FT                   DWQLRNRIKAVYHLLSAIDLRGRSMSKIELISALTGATRASAARVLEADAELERSAKSA
FT                   PRWDLPAELASTIVEIEWTQKSILGAWPETLSGSQGTPDARLIADIATLTDNYTSVRVG
FT                   DVLRY"
XX
SQ   Sequence 6099 BP; 1658 A; 1545 C; 1622 G; 1274 T; 0 other;

U01059  Length: 6099  December 21, 2001 15:57  Type: N  Check: 4968  ..

       1  gaaaaactat ccccgctggt cggtgggccg atacccaatc ggtctatgga
      51  gggaattcaa atagggctct ggtagtccgc tcgccatcgc cttcggtctt
     101  tccgttatgg aaggtttgct tacggtccac gtaggttctc cgaccttgcg
     151  aggaaagatt gcgctgcttt gcagttccct taactggggc gggttaggac
     201  gtcggtaggg tgcctgtggc cctgcggcag gcggatctag cacgtaacgt
     251  atcccttgcc agggagagcg tgccgaattg ctatgggttg gtgtaggtcc
     301  tcggttgtgt acggctcctc gtccacctac atcacacatg agaaactgat
     351  gacgacacag gcgtgtctag gactcatgcg taactgctcc gatgggatat
     401  taggtgtaac gactgcctgt aaagttaaag agttagcaac tcgggctgac
     451  cagtctgccc tttgcgtggg gtgtggcata cgctaggacg tggacaaaaa
     501  caacaaacta acaacaacaa caccaagcca aaaagaaaga tggaacaagc
     551  agctatcccc cttaatcagg gcagcaacac cgcgatgtcg gaggatatcg
     601  ggctagccgc taacatttta cctgtcgaac aagacgacca ggcttctgat
     651  tccgcaagcg tggcagacca aaataacctt attgaaaaca acctcctacc
     701  tgatgagttg gaggcacaaa aaattagaaa aaccctcgaa aacgataaaa
     751  aaccagaaaa cgttaaaaaa gaaaaaacta ctggtgagtt cactgatgta
     801  gtgcagagcg ccggacttat ggcagatcgg gtgcaagagg tggtcgacgt
     851  ggcgacctgg gctaaagatg ttgcaatctg ggcagaattc aacgctttcg
     901  ataggaatgc cagtgcgacg cgccaagatc ctattaagac gagtgcgatc
     951  gactggttgc taaatcaagc tccaacacac caactggact caaccagtgc
    1001  taatccccct acttgggtac cggtcggttg gggtggcaaa cccaactatg
    1051  ccttaacgat aagcaggaga atcttaatag ctatcgatgc agctgaaggg
    1101  gcaaggcatg atgtctacgt gaccgactca gctaatttag gcatcgcgtg
    1151  gcctgatata ggtcatcctg actcgccgta cgcgccttcg gaggttcgag
    1201  gccgtccatc catgaaacac tacaatgctg ctgtgagccc gcaaatcatc
    1251  tccaagataa cccagactct cgatccgacc acggcaaaat tctggcagac
    1301  gagcctccag cttaaaaatg agactgacgc tatgtggatc ttgcgatacc
    1351  gtgctaaagg tgcgcaggtc ggggataacc acctcccttt actagtagca
    1401  gcgtggcagt actactttga cgcttgtcgt gcgcatgctg ccggcttggt
    1451  gtgctctaag cttggccaac gcaccgcagg ctacgcatac aacatctaca
    1501  aagacaccaa ctggatcagc tcagtggcag agcaagggaa agagatcgtc
    1551  aactgcattg gtatgccgca agactacgca actttctggg cgatgtgttg
    1601  tctcccgacc caggagattt ttgcggcgcg gaccgacgcg ctggggacat
    1651  tgtataagac cccattcggc gcatggcgcc gacgtatgcg taccgagatg
    1701  tgtgtgatat ccgagcatac ggtcacctat ccatctacag caccgaattg
    1751  gtggactaac ccgaacctaa tcttgggttt catggagatg tactctatga
    1801  agttcgggct cgatgatcag atgaacgacg ctctttatgt ggccttactt
    1851  atacccttga tgacagtcgt cggcactccg ataacactac cagaaccagt
    1901  gcattccaaa gattggttcg aaggacttgt cgaacttgga cagggcttag
    1951  atgctgtcag acagctacat ttgtcgtcac cgacggcaac cactgcggcc
    2001  tggtccacaa gccaatctgt tatgattggt atcttaggag aagtagctga
    2051  ggccgagcta gcccaacgtg aaggagtagc aattagccag aacaccgcag
    2101  cgaacgtcat taggacggtg gctatggcat tgagccggcc aggatcgttt
    2151  acagctacaa tcctctgcaa actcatgcac tttcccagca cagcaatcga
    2201  attggccggg ttacaaacgt catttgtgcc cgcgggatcg ctagttcccc
    2251  cgccgctctg gaactataga aggttggcat tatggcaaca caaccttgtc
    2301  cctatccggg ctagccgcag ctacctgagt catggtccta acttcaacag
    2351  gctgtggaag cccgaaggta cactgacccc ggcgcacttc gtcacgacgg
    2401  tgaacgagtt gcaagtctta aggaggtata gaatactgga cgtagtggtg
    2451  agcggccaaa gcgaactgat cccattcgac attgtttgga cagccagcac
    2501  cgggcgcgtg actataccag caatggatcc tgccctgcgg gagaagatcg
    2551  ccttagtgaa gaaatacggg gtcaagctct atgatgtcgg atcggctggt
    2601  gttggatacc tggaccaacc cgaacgcgac ccagctgaag cggtagagct
    2651  ttacaactct tggcaataca tgggtataac tccatcggtc gcaggatcag
    2701  acgtccagta cggaggcttt gtctacgacc gcccacagac agggggactt
    2751  ccagatgatt taaatggacc acaggcctat tccatcacat cggcaataga
    2801  tgcagctgaa gcggcaggaa tgatgaagag acaggccatc ttccgcaaac
    2851  tagcaacctt cggcgccagg ggagagatca ggacgtccca gggcaactcc
    2901  tcggcgttgc tccctgtaaa cagcgctaca acagaagaga gacgcgacct
    2951  cagtgagaac tgtggttggc agggcctggt gaagctaggg gtggggtacc
    3001  caactgtcca agcactaaaa cgcgcagtgg caggccggtt agggaatgat
    3051  ccaatgtgga cagcttcctt acctgataaa ttgtcactgg acgaactctc
    3101  cgttattgcg ggtgttttga agatagattt gatgctagtc gagtgccgcc
    3151  tgccggacca ggtggttact tgtgtggttg gtgaccctga ttacaagcga
    3201  gttctctact tagcggacga tcattgggat actcacccat cgagacagct
    3251  ccttcatgca gctaccagtg ccaccagcaa ccgttcagaa gccgtggcta
    3301  agccgacagt tgaaatctct gacaaaacaa gggcagtgat atacgagcag
    3351  gcaatcgaaa agtacaacgt caatagtctg actaaacaag ggctgttaga
    3401  gacccatgcg gacctcttcc cacatcgaga gccgccacgg tcactgctgg
    3451  ctgctgcacc tagagccaat agccccgcag aatcacttgg tgcaggggct
    3501  tgcgaatgcg gctgcgcgcg tatcgcatcg aaagcaactc aagcctgcga
    3551  ccagatactc gagttgatgg cgatggaaac agcctttccc cacaggaacg
    3601  caacaacatc caagaagaac aacctgcagg tcaaagatat atgcaagatc
    3651  atcatccaaa aacttaagaa tcccaaaacc atgaaaccca atgctagatt
    3701  cggctgtgca gcggcttggt tgctgcgttc ccaaggacaa gcagcggaat
    3751  tcgtgacgtc ggtcgcggca tgggtggtgt ctaaccgaat aggaccagct
    3801  gcgtggaagt ggctatgggt cggaaaaggc ctttaccaga cgaacgaaga
    3851  cgactgggtc gcaaaagcca aaagcataca tgacgacttg cggaaacacg
    3901  gttacccacc gcatgtacaa gcgaccgaag aagactggtc acaaagtctg
    3951  tatctgcaag ctttgtacgg caggggaggc gtcctggtaa actgggctga
    4001  agacttcgca aacaaagcca gccacccgga ccctatccaa gcttgggacg
    4051  ggcgctgtta tagccagaaa ctagccacag agataataaa tgaaactgtc
    4101  aattcagtgg tggaaactgc ttacccgaaa gctgtacctc aaagtttcga
    4151  ccggttcatg gacaatgcat acgaatggct ggtttctggt tcatcggctg
    4201  gcatacctag cccgctcaag aactctccga tgcgtgatct cgtactgaag
    4251  gagtatggtt tgagccccag gcccaccaaa cgttcggtta tggaagcaat
    4301  cccgcgtgac aaagtgttga aaattttgac cgagacatca ccaaagattg
    4351  tggcaaaagc acatatgaag ctgaacgaga caggaggtaa agcgagggcg
    4401  atctacggtg tgacgctatg gcattacatt ttctctaatt ggctgatggc
    4451  tccggtagaa aaacacttga accatcgttc agtagacatc aacctagacg
    4501  ggtcagcgat gctaaccgct acgctgcacc gtttgggcca agtcgaagca
    4551  aacatggtct tcaactccta cgactaccct gacttcaatt caatgcacac
    4601  ttatgagcac atggcttcga tctacagggc cgcgaaacgc tgtgcaatta
    4651  aggagctccg gcagaggaga ggggcacagg tctcagacca agacctggct
    4701  ctcatagaac acgggtttga ttggttgatc gaatcagttt accaccagta
    4751  cgtcatacat ccagacactg gggcaatcat aaaaaccgcc agtggtttat
    4801  acagtggtga ccgcgacact acgctcatca acaccttact gaacatagct
    4851  tatgcttctg tcacagatag gtcgatggcg cacaagtatg ttgaccctgg
    4901  agtggttgaa cgtctatgtc atggtgatga tatcatcaca gtgcatcgct
    4951  cactcccagg agcgatgctg tggaacgacg aggcggcaaa gtgcaacctt
    5001  aaaggtcagg aatcaaaact gatgatagac cacaaacatc acgagtacct
    5051  aaggatcatg gggtgcgacg atgtcaaact gagggggtgc ttagcaagat
    5101  gtgtggccac gtacgtgaac gggaactggg agactgagcg tgtggttggc
    5151  gtttgggcaa aattgcaaga agcggcaagc tccctagcaa cgtggattag
    5201  gaggggcgca tctcaggaaa tcgtccaaga gctctggtat atcagccgat
    5251  atcgaatgct gacggagacc tacaggttta cgcccacaga cgctaagtct
    5301  ctcaacatcc gggatagtcc tcagtcttca aacacagcga ctctttccta
    5351  cgaacagctc ccggccaatg tgacgagccc gtacataaag aagctggtgg
    5401  cagaattacc ccacgatctc aggccaacta gcaaagagct aggtcaactg
    5451  cgtagagtgc tacagaagtc tacctacggt accgaactgc cactaactta
    5501  ccaacagacg gatctaacca aaatcagtga tggtgcgatt gagacagtcc
    5551  ggacattggg tggagctgcg gggagggtat tcaacagtcc tgattaccac
    5601  aaactcaaac tcgaaggtac agcaaaatcg gattggcagc ttaggaaccg
    5651  gattaaagct gtttaccatc tgctatctgc tatagacttg agaggacggt
    5701  cgatgtctaa aattgagtta atttctgcgc tcacgggggc cacgcgcgcg
    5751  tcggcagccc gggtactcga ggcggacgca gaactggaaa ggtcggcaaa
    5801  atccgctccg aggtgggacc tcccagcgga actcgcgtca accatagttg
    5851  agatcgaatg gacccaaaaa agtatcttag gagcatggcc ggaaacactg
    5901  tcgggatcac aagggacgcc agacgcgcgt ttgattgcag acatcgcaac
    5951  attaaccgat aattacacaa gtgtgagggt cggtgatgta ctccgctact
    6001  aagtagcagc gcttcttcaa agcgcaaact aggtgcttaa cacctatcca
    6051  aagttaagag caaaacacta ccccaaggag aacctggggt ggaaaatca