Sequence of DPV Helminthosporium victoriae virus 190S

Helminthosporium victoriae virus 190S coat protein and RNA dependent RNA polymerase genes, complete cds.

ACC No: U41345

Dated: 2007-02-06 | Length: 5179 | CRC: 295163416

                
ID   U41345; SV 2; linear; genomic RNA; STD; VRL; 5179 BP.
XX
AC   U41345;
XX
DT   09-JAN-1998 (Rel. 54, Created)
DT   06-FEB-2007 (Rel. 90, Last updated, Version 2)
XX
DE   Helminthosporium victoriae virus 190S coat protein and RNA dependent RNA
DE   polymerase genes, complete cds.
XX
KW   .
XX
OS   Helminthosporium victoriae virus 190S
OC   Viruses; dsRNA viruses; Totiviridae; Totivirus.
XX
RN   [1]
RP   1-5179
RX   DOI; 10.1073/pnas.93.22.12541.
RX   PUBMED; 8901618.
RA   Huang S., Ghabrial S.A.;
RT   "Organization and expression of the double-stranded RNA genome of
RT   Helminthosporium victoriae 190S virus, a totivirus infecting a plant
RT   pathogenic filamentous fungus";
RL   Proc. Natl. Acad. Sci. U.S.A. 93(22):12541-12546(1996).
XX
RN   [2]
RP   1-5179
RA   Ghbarial S.A., Nibert M., Xu L.L., Talkington M.W.T.;
RT   "Victorivirus: a new genus in the family Totiviridae";
RL   Unpublished.
XX
RN   [3]
RP   1-5179
RA   Ghabrial S.A., Huang S.;
RT   ;
RL   Submitted (27-NOV-1995) to the EMBL/GenBank/DDBJ databases.
RL   Said A. Ghabrial, Plant Pathology, University of Kentucky, S-305 Agr. Sci.
RL   Bldg. North, Lexington, KY 40546, USA
XX
RN   [4]
RC   Sequence update by submitter
RP   1-5179
RA   Ghabrial S.A., Huang S.;
RT   ;
RL   Submitted (05-FEB-2007) to the EMBL/GenBank/DDBJ databases.
RL   Said A. Ghabrial, Plant Pathology, University of Kentucky, S-305 Agr. Sci.
RL   Bldg. North, Lexington, KY 40546, USA
XX
CC   On Feb 5, 2007 this sequence version replaced gi:2745954.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .5179
FT                   /organism="Helminthosporium victoriae virus 190S"
FT                   /mol_type="genomic RNA"
FT                   /db_xref="taxon:45237"
FT   CDS             290. .2608
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /db_xref="GOA:O57043"
FT                   /db_xref="InterPro:IPR002345"
FT                   /db_xref="InterPro:IPR008871"
FT                   /db_xref="UniProtKB/TrEMBL:O57043"
FT                   /protein_id="AAB94790.2"
FT                   /translation="MSHTTITNFLAGVIARPQGGNITSDETFRRYRTIVRTSATIGGNE
FT                   DSRTTSIFHEIGRAVNTKGKALAVAGMEAPLVEASYPTNAVLVEDFIGLAKKYTNFSAT
FT                   FEYSSLAGVVERLARGLAACSVFEDVTSTDLRGNNPLAVHALATYDGPVNSLTSAVFIP
FT                   RLVNNALTGDVFAVLCNCVAGEGGTVVTDTIELDANTRQPIVPEVGPLGVPGAIVDALR
FT                   LLGSNMIASDQGPLFALALTRGIHRVLSVVGHTDEGGIVRDLLRCGGFGLPFGGIHYGL
FT                   EEYSGLPALQFNSAAATAAYVDGIALVTAAVVAHADPGERYNGEWFPTFFDGTTHADTM
FT                   RRSGDSTEGTAAMADRNRAQLLARQQLFWRPYITALGACFSTAGDISVAERFQCAASHS
FT                   LGADPRHLRLPSVAPYFWIEPTGLIPHDFLGSVAEEEGFASYCWRDTTRTRPAWDSIVL
FT                   SGARDTTFSAYHIRMKGARTAWFLAHWLGHPENGLGATRVRQLDPNAVLHPGPCEGNEQ
FT                   VRDRVEADLPLTDYLWRRGQSPFPAAGELLNLTSEWGILFRHVTFTDDGDLNPEHLPAA
FT                   HEMADTTVTMTVGRPIGIAPGRSNAGDNQARRARTRASVELSAASRRARVFGRPDVGEM
FT                   PTLTSAPAPIPASPAYDGNRGGEAGGVTGRGNNRSAAPGHASWSERQADGVPVNVTPHH
FT                   NALRAPPFPRQQGALGGGGNVPLPPAPGAAPPPPPGPPNGPPAGPPPSDDGSSNPAAPV
FT                   PTAIHAPPAAAQADRAEGQ"
FT   CDS             2605. .5112
FT                   /codon_start=1
FT                   /product="RNA dependent RNA polymerase"
FT                   /function="dsRNA replication"
FT                   /note="RDRP"
FT                   /db_xref="GOA:O57044"
FT                   /db_xref="InterPro:IPR001795"
FT                   /db_xref="UniProtKB/TrEMBL:O57044"
FT                   /protein_id="AAB94791.2"
FT                   /translation="MSDPQERSKAYGLLGERLYAVASANSHMLAGYDSLDFTARLVRLT
FT                   GEATALKAVDPLLPCAVSLLFMDFPLQLPCTPEETLRLVRRAYDPNTLEEVDYSTLSGY
FT                   ATQFARVKGQRGRWRHLGHLVCNDKAFRERYFPKKKHAAAAIKTNIRLGPLARAWAARY
FT                   GLAALGSHLAYMVGMPNDRACATLLLAQTYKARFGSEGVAWAIASVRQPENAKGLSNAL
FT                   KALGSNTSEPGALFVEANTLQGRYDRTLDMDHEVESRCSPAAIADQVIPYTDELGACID
FT                   FILDTELGGDTIELPDEDEWWTSRWLWCVNGSQNALSDKALGIKNKSGQRYRRMAAEEV
FT                   NNNPVPAWNGHTSVSPSVKLENGKDRAIFACDTRSYFAFTYWLTPIEKKWRGARVILNP
FT                   GEGGLYGTARRIRGSQTSGGVNLMLDYDNFNSQHSNETMAALYEKALSRTNAPAYLKKA
FT                   VAASVESTYIHYKGRDRHVLGTLMSGHRATTFTNSVLNAAYICYAVGIPAFKRMISLHA
FT                   GDDVYLRLPTLADCATTLNNTKRVGCRMNPTKQSIGYTGAEFLRLGINKSYAIGYLCRA
FT                   IASLVSGSWTSLDELQPLNALNGAIVQTRSCLNRGAATGLPELISASFVGLRGFKRRDL
FT                   LELLTGVATIKPGPVYTSSCVIREYVVEQPPPPQFDVPPGAGMHATMSYLARHTTLVEA
FT                   QALEIARPAIKSLMLSSSYGKAGPGAQTRPHVPMPKLRRQPPRVAVGFSMAHELTGRGV
FT                   KEGCLSGHPLLRLFEQRLTDDDLRALVALVGGNTSAKDIRAEAFGAESSSSTIMGILPH
FT                   SDASNYCKRTRNGNIIVPYHIRS"
XX
SQ   Sequence 5179 BP; 1059 A; 1568 C; 1442 G; 1110 T; 0 other;

u41345 Length: 5179  06-FEB-2007  Type: N  Check: 3853  ..

       1  gaaatttagg gcacacacga actctcagtt cttgcccgca cggtagtccg
      51  atgcctacgc tcccctgggg gctatcgagg cggcaacatg ggtgtgtttt
     101  cggtgttcaa gaagagcctg tcgtctccca agcgactagg gttgcctcgc
     151  actgtatagt gtagttcgcg acccgaagag caagggtggt gttggttggc
     201  gagggggggc ttcggccttc cgttgaccca actgatatca cacttatctt
     251  cttgactcaa cggatttgaa aaacgaaccc taaatttcca tgtctcacac
     301  cacgatcacc aacttccttg ccggcgttat cgctaggccg cagggaggaa
     351  acattactag cgacgaaacg ttcagacgtt atcggacaat tgtgcgcacc
     401  tcagccacta tcggtggcaa tgaggactcg cgcacgacct cgatctttca
     451  cgagatcggt cgggctgtca acaccaaagg aaaggcgttg gcagtcgccg
     501  gcatggaggc tcccttagtc gaagcctcct atccgacgaa cgccgtcctc
     551  gtcgaggatt tcatcggttt ggcgaagaag tacaccaact tcagcgccac
     601  tttcgagtac tcctctttgg ccggcgttgt ggagagactt gcccgcggct
     651  tggccgcttg tagcgtcttt gaagacgtca cgagtaccga tttgcggggc
     701  aacaaccctt tagctgtcca cgccctcgcg acttacgatg ggccagtgaa
     751  cagcttgact tccgcggtat ttataccgcg tttagtcaat aatgccctca
     801  ccggcgatgt cttcgccgta ctttgtaact gcgttgccgg cgagggtggt
     851  accgtagtga ccgacacgat cgagcttgac gcgaatacgc ggcagccgat
     901  cgtgcctgag gtcggcccct taggcgttcc cggggcgatt gtcgacgccc
     951  tacgcctttt gggcagcaac atgatcgcca gcgatcaagg ccccctcttt
    1001  gctcttgccc tcacccgggg catacaccgt gtgttatccg ttgtgggtca
    1051  cacggatgaa gggggcatcg tccgcgatct gttgcgctgt ggtggtttcg
    1101  gtctgccttt cggaggcatc cactacggcc tggaggagta tagcgggttg
    1151  cccgccctcc agttcaattc tgctgctgcc accgcggcct atgtcgatgg
    1201  cattgccctc gtcaccgccg cggttgtcgc ccacgctgac ccgggtgaaa
    1251  ggtacaacgg cgagtggttt ccgacgttct tcgacggtac cactcatgcc
    1301  gacactatgc ggcgctcggg tgattccacc gaagggacgg ctgccatggc
    1351  ggacagaaac cgcgcacagt tgcttgcgcg ccagcagcta ttctggcgtc
    1401  catacatcac tgccttagga gcatgttttt ctacggccgg tgatattagc
    1451  gtggctgagc ggttccagtg tgcggcctct cactcactag gggccgaccc
    1501  gcgacacttg cgactcccgt cagtcgcccc ttacttttgg attgagccga
    1551  ccggcttgat cccccacgat ttccttgggt ctgtggctga ggaagaaggt
    1601  ttcgcgtcgt actgctggcg cgacaccacg agaacaaggc ccgcttggga
    1651  ctcaatagtt ttaagcggcg cgcgggacac gaccttcagt gcgtatcaca
    1701  tacgtatgaa gggcgccagg acggcttggt tcttggccca ctggttgggc
    1751  cacccagaga atggtctcgg cgcgactcgc gttaggcaac ttgaccctaa
    1801  cgcggtacta catcccggcc catgtgaggg taatgaacag gtgcgggacc
    1851  gagttgaggc ggacttaccc ctcacagatt atctatggcg gcggggccag
    1901  tcacccttcc ctgccgccgg tgagttgctc aacctcacat ccgagtgggg
    1951  tatactcttc aggcacgtca ccttcaccga cgatggggac ctcaaccccg
    2001  agcacctccc cgcggcccac gagatggccg atacaacagt cactatgact
    2051  gttggtcgcc ctatcgggat cgcaccggga cggtctaacg ctggggacaa
    2101  ccaggcgcga cgagccagga ctcgtgcgtc ggtagaactg tccgcggctt
    2151  cccggagggc tcgcgtcttt ggccggccag atgtcggtga gatgcccacc
    2201  ctcactagtg cccctgcgcc gattccggct agcccggcgt acgacggcaa
    2251  tcggggtggt gaggcaggtg gtgtcaccgg acgaggaaac aacaggtccg
    2301  ccgcgcctgg ccatgcctct tggtctgaga ggcaagcaga cggagtccct
    2351  gtcaatgtga ctcctcacca taacgcgttg cgtgcccccc cattccctag
    2401  acaacagggc gcgctcggtg gcggcggcaa cgtgccactg cccccagctc
    2451  caggtgccgc cccgcctcca ccccctggcc caccaaacgg tccccctgcc
    2501  ggcccacctc cttccgacga tggatcttcc aaccctgctg cccccgtccc
    2551  cactgccatc cacgcacccc ccgccgctgc ccaggctgat cgggccgagg
    2601  gacaatgagt gatcctcagg aacgttccaa agcctacgga cttctcgggg
    2651  aacggttata cgctgtagcg tcagccaatt cccatatgct tgctggttac
    2701  gactcactgg atttcactgc gcgactcgtc cgcttgacag gagaagctac
    2751  ggccttaaag gctgttgacc ctctcttgcc ctgcgccgtt tcgctcttgt
    2801  ttatggactt ccctctccaa ctgccgtgca ctcctgagga gacacttagg
    2851  ttggtgagaa gggcctatga ccctaacaca ctggaagagg ttgattactc
    2901  aacgctctcg gggtacgcga ctcagttcgc gagggtcaaa ggtcaacgtg
    2951  gtaggtggcg acacctcgga catttggtct gcaacgacaa ggcctttcgc
    3001  gaacgttact tccctaagaa gaagcacgcc gcagcggcca ttaagaccaa
    3051  catacgtctc ggtcccttag cccgggcttg ggctgccagg tacggtctag
    3101  ctgccctcgg ctcgcatctc gcttatatgg ttggcatgcc aaatgaccgc
    3151  gcttgtgcga ccttgctcct tgcacaaacc tacaaagcta ggtttggaag
    3201  cgagggcgta gcgtgggcta tcgcttcggt ccgccaacct gagaatgcca
    3251  agggcctcag caatgcactc aaagcgctcg gttcaaacac ctccgaaccg
    3301  ggcgctttgt tcgtggaggc taacactctg cagggtaggt acgaccggac
    3351  tctggacatg gatcacgagg ttgaatctcg ctgctccccc gccgctatcg
    3401  cagaccaggt gatcccttac acggatgaac ttggggcgtg catcgacttc
    3451  atccttgata cggaactcgg tggcgatacc attgagttgc cggatgagga
    3501  tgagtggtgg acttcacgct ggttgtggtg cgtcaatggc tcacagaatg
    3551  ccctatctga caaggctttg ggcatcaaga acaagagtgg ccaaaggtac
    3601  aggcgcatgg ctgctgaaga ggtcaacaac aatcccgtac ctgcgtggaa
    3651  tggtcacact tctgtgtccc caagcgtcaa gctcgagaac ggtaaagacc
    3701  gggccatctt tgcatgcgac accaggagtt acttcgcgtt cacgtactgg
    3751  ctgaccccca tcgaaaagaa gtggcgcggc gcacgtgtga tactcaatcc
    3801  tggggagggt ggcctctatg ggacggctcg tcgtatccgt ggcagtcaga
    3851  cctctggtgg tgttaacctt atgctggact atgacaactt caacagccag
    3901  cattccaacg agacaatggc cgccttgtac gagaaggcat tgtcgcgcac
    3951  taacgccccg gcttacctga agaaggctgt cgctgcaagt gttgagtcga
    4001  cctacatcca ctacaagggt cgtgataggc acgtgcttgg cacccttatg
    4051  tccgggcacc gcgcaaccac tttcacgaat agtgtcctca atgccgccta
    4101  catatgttat gctgtcggaa tacctgcctt caaacgcatg attagcctac
    4151  atgcgggaga tgatgtttac cttaggctac caactcttgc tgattgcgcg
    4201  acaacgctca acaacacaaa acgcgtcggg tgccgaatga acccgacgaa
    4251  gcagagtatt ggatacaccg gtgctgaatt cttacgactt gggatcaaca
    4301  agtcgtacgc catcgggtat ctatgtcgtg caatcgcttc gctcgtctct
    4351  gggtcttgga catccctgga cgagctccaa ccgctcaacg cacttaacgg
    4401  tgcaattgta cagacgagga gctgtctcaa caggggcgcg gcgactggat
    4451  tgcctgaatt gatcagcgca tcgttcgtcg gcctgcgtgg cttcaagagg
    4501  cgtgacctac ttgaattact tacgggtgtc gccactatca agcccggccc
    4551  tgtttacacc tcctcgtgtg taatacgcga gtacgtagtt gagcaacccc
    4601  ccccaccaca gttcgacgtc ccccctggtg ccggtatgca cgctaccatg
    4651  tcatacctag ccagacacac caccttggtt gaggcccaag cgctcgaaat
    4701  cgcgcgaccg gcgatcaagt ccctgatgct ctcgtcatct tacggcaaag
    4751  ccggacctgg agctcaaact cgaccgcacg tcccgatgcc gaagcttagg
    4801  cgccaaccac ctagggtggc tgtcggcttc tctatggcac acgaactgac
    4851  cggcagaggg gtcaaagagg gttgtctatc gggccacccc ctgctcagac
    4901  tatttgagca gaggctgacc gatgatgacc tgagagcatt ggtagcgctc
    4951  gtcggcggaa acacttccgc aaaagacatc cgtgcagaag ctttcggtgc
    5001  tgaaagctcg tcgtccacta tcatggggat actacctcat tcggacgcgt
    5051  caaactactg caaacgtact cgcaatggca acataatcgt gccatatcat
    5101  atccgttctt aaacgaagac gtagcaccac gtgccgcaag atgcggcttc
    5151  accatttggg ccggcaaggg ccaaaaagc