Sequence of DPV Citrus tristeza virus

Citrus tristeza virus p23 protein gene, complete cds.

ACC No: U42006

Dated: 2001-11-28 | Length: 630 | CRC: -248215337

                !!NA_SEQUENCE 1.0
ID   CT42006    standard; RNA; VRL; 630 BP.
XX
AC   U42006;
XX
SV   U42006.1
XX
DT   01-JUL-1996 (Rel. 48, Created)
DT   28-NOV-2001 (Rel. 69, Last updated, Version 3)
XX
DE   Citrus tristeza virus p23 protein gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-630
RX   MEDLINE; 97189518.
RX   PUBMED; 9037736.
RA   Pappu S.S., Febres V.J., Pappu H.R., Lee R.F., Niblett C.L.;
RT   "Characterization of the 3' proximal gene of the citrus tristeza
RT   closterovirus genome";
RL   Virus Res. 47(1):51-57(1997).
XX
RN   [2]
RP   1-630
RA   Pappu S.S.;
RT   ;
RL   Submitted (05-DEC-1995) to the EMBL/GenBank/DDBJ databases.
RL   Sita S. Pappu, Plant Pathology, University of Florida, 1453 Fifield Hall,
RL   Gainesville, FL 32611-0680, USA
XX
DR   SPTREMBL; Q66252; Q66252.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .630
FT                   /db_xref="taxon:12162"
FT                   /organism="Citrus tristeza virus"
FT                   /strain="Stem pitting strain B128 from Colombia"
FT                   /specific_host="Citrus spp."
FT   CDS             1. .630
FT                   /citation=[1]
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:Q66252"
FT                   /evidence=EXPERIMENTAL
FT                   /function="unknown"
FT                   /product="p23 protein"
FT                   /protein_id="AAB03196.1"
FT                   /translation="MDNTSGQTFISVNLSDESNTASTEIKAVSSEADRLEFLRKMNPFI
FT                   IDALIRKNNYQGARFRARIIGVCVDCGRKHDKASRTERKCKVNNTLVQNEVAHMLMHDP
FT                   VKYLNKRKARAFSNAEMFAIDLVMHTKERQLAVDLAAEREKTRLARRHPMRSPEETPEH
FT                   YKFGTTAKAMLPDINAVDVGDNEDTSSEYPVSLSVSGGVLREHHFI"
XX
SQ   Sequence 630 BP; 195 A; 125 C; 157 G; 153 T; 0 other;

 U42006  Length: 630  December 21, 2001 15:58  Type: N  Check: 6820  ..

       1  atggataata ctagcggaca aacttttatt tctgtgaacc tttctgacga
      51  aagcaacaca gctagtactg aaatcaaagc cgtaagttcg gaagcggatc
     101  gcttggaatt tttacggaaa atgaatccct tcattatcga cgctttgata
     151  cggaaaaata attatcaagg cgctcgcttt cgcgcgagaa taataggagt
     201  gtgcgtggat tgtggtagaa aacacgataa ggcatcgagg actgaacgta
     251  agtgtaaggt caacaatacg ctagtccaga acgaggtggc gcatatgtta
     301  atgcacgatc ccgtaaaata tttaaataaa agaaaagcta gagccttttc
     351  taacgcagag atgtttgcga tcgatttggt tatgcacacc aaagaaaggc
     401  aattagcggt tgatttggcc gctgaaaggg agaagacgag attggctcgt
     451  agacacccga tgcgttctcc ggaagagact ccggaacatt ataaattcgg
     501  tacgactgct aaggcaatgt taccggacat caacgctgta gacgttggtg
     551  ataacgaaga cacctcgtcg gagtacccag taagtctgag tgtttccggc
     601  ggagttctcc gtgaacacca cttcatctga