Sequence of DPV Citrus tristeza virus

Citrus tristeza virus p23 protein gene, complete cds.

ACC No: U42018

Dated: 2001-11-28 | Length: 630 | CRC: 1085644998

                !!NA_SEQUENCE 1.0
ID   CT42018    standard; RNA; VRL; 630 BP.
XX
AC   U42018;
XX
SV   U42018.1
XX
DT   01-JUL-1996 (Rel. 48, Created)
DT   28-NOV-2001 (Rel. 69, Last updated, Version 3)
XX
DE   Citrus tristeza virus p23 protein gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-630
RX   MEDLINE; 97189518.
RX   PUBMED; 9037736.
RA   Pappu S.S., Febres V.J., Pappu H.R., Lee R.F., Niblett C.L.;
RT   "Characterization of the 3' proximal gene of the citrus tristeza
RT   closterovirus genome";
RL   Virus Res. 47(1):51-57(1997).
XX
RN   [2]
RP   1-630
RA   Pappu S.S.;
RT   ;
RL   Submitted (05-DEC-1995) to the EMBL/GenBank/DDBJ databases.
RL   Sita S. Pappu, Plant Pathology, University of Florida, 1453 Fifield Hall,
RL   Gainesville, FL 32611-0680, USA
XX
DR   SPTREMBL; Q66254; Q66254.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .630
FT                   /db_xref="taxon:12162"
FT                   /organism="Citrus tristeza virus"
FT                   /strain="B28 from Florida"
FT                   /specific_host="Citrus spp."
FT   CDS             1. .630
FT                   /citation=[1]
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:Q66254"
FT                   /evidence=EXPERIMENTAL
FT                   /function="unknown"
FT                   /product="p23 protein"
FT                   /protein_id="AAB03198.1"
FT                   /translation="MDNTSGQTFISVNLSDKSNTASTEVKTVSSEADRLEFLRKMNPFV
FT                   IDALIRKTSYQGARFRARIIGVCVDCGRKHEKGSRTERKCKVNNTQSQNEVAHMLMHDP
FT                   VKYLSKRKARAFSNAEMFAIDLVMYTKERQLAVDLAAEREKTRLARKHPMRSPEETPEH
FT                   YKFGMTAKAMLPDINVVNVGDNEDTSSEYPVSLSVSSGVLREHHLI"
XX
SQ   Sequence 630 BP; 198 A; 123 C; 153 G; 156 T; 0 other;

 U42018  Length: 630  December 21, 2001 15:58  Type: N  Check: 6874  ..

       1  atggataata ctagcggaca aactttcatt tccgtgaacc tttctgacaa
      51  aagcaacacg gctagtactg aagttaaaac cgtaagttct gaagcggatc
     101  gcttggaatt tttacggaaa atgaatccct tcgttatcga tgctttgata
     151  cggaaaacca gttatcaggg tgctcgcttt cgcgcgagaa taataggagt
     201  gtgcgtggat tgtggtagaa aacacgaaaa gggttcgagg actgaacgta
     251  agtgtaaggt caacaacaca cagtctcaga acgaggtggc gcatatgtta
     301  atgcacgatc ccgttaagta tttaagtaaa agaaaagcta gagccttttc
     351  taacgcagag atgtttgcga tcgatttggt tatgtacacc aaagaaaggc
     401  aattagcggt tgatttggcc gctgaaaggg aaaagacgag actggctcgt
     451  aaacacccaa tgcgttctcc ggaagaaact ccggaacatt ataaattcgg
     501  tatgactgct aaagcaatgt taccggacat caacgtcgta aacgttggtg
     551  acaacgaaga cacttcgtcg gaatacccag taagtctgag tgtttctagc
     601  ggagttctcc gtgaacacca cttaatctga