Sequence of DPV Citrus tristeza virus

Citrus tristeza virus p23 protein gene, complete cds.

ACC No: U42020

Dated: 2001-11-28 | Length: 630 | CRC: 845735405

                !!NA_SEQUENCE 1.0
ID   CT42020    standard; RNA; VRL; 630 BP.
XX
AC   U42020;
XX
SV   U42020.1
XX
DT   01-JUL-1996 (Rel. 48, Created)
DT   28-NOV-2001 (Rel. 69, Last updated, Version 3)
XX
DE   Citrus tristeza virus p23 protein gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-630
RX   MEDLINE; 97189518.
RX   PUBMED; 9037736.
RA   Pappu S.S., Febres V.J., Pappu H.R., Lee R.F., Niblett C.L.;
RT   "Characterization of the 3' proximal gene of the citrus tristeza
RT   closterovirus genome";
RL   Virus Res. 47(1):51-57(1997).
XX
RN   [2]
RP   1-630
RA   Pappu S.S.;
RT   ;
RL   Submitted (05-DEC-1995) to the EMBL/GenBank/DDBJ databases.
RL   Sita S. Pappu, Plant Pathology, University of Florida, 1453 Fifield Hall,
RL   Gainesville, FL 32611-0680, USA
XX
DR   SPTREMBL; Q66256; Q66256.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .630
FT                   /db_xref="taxon:12162"
FT                   /organism="Citrus tristeza virus"
FT                   /strain="B67, mild isolate from China"
FT                   /specific_host="Citrus spp."
FT   CDS             1. .630
FT                   /citation=[1]
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:Q66256"
FT                   /evidence=EXPERIMENTAL
FT                   /function="unknown"
FT                   /product="p23 protein"
FT                   /protein_id="AAB03200.1"
FT                   /translation="MDNTSGQTFVSVNLSDESNTASTKVENVKSEADRLEFLRKMNPVI
FT                   IDALVRKTNYQGARFRARIIGVCVDCGRKHDKALKTERKCKVNNTQSQNEVAHMLMHDP
FT                   VKYLTKRKARAFSNAEMFAIELVLYTKERQLAVDLAAEREKTRLARRHPMRSPEETPEH
FT                   YKFGMTAKAMLPDINAVDVGDSEETSSEYPVSLSVSGGVLREHHFI"
XX
SQ   Sequence 630 BP; 190 A; 126 C; 162 G; 152 T; 0 other;

 U42020  Length: 630  December 21, 2001 15:59  Type: N  Check: 8848  ..

       1  atggataata ctagcggaca aactttcgtt tctgtgaatc tttctgacga
      51  aagcaacacg gcaagcacta aagttgaaaa cgtaaaatcg gaagcggatc
     101  gcttggagtt tttacgtaaa atgaatcccg ttattattga cgctctggtg
     151  cggaaaacca attatcaggg tgctcgcttt cgcgcgagaa taataggagt
     201  gtgcgtggat tgcggtagaa aacacgacaa ggcgctcaag actgaacgta
     251  agtgtaaggt caacaatacg caatctcaga acgaggtggc gcatatgttg
     301  atgcacgatc ccgttaaata tttaaccaaa agaaaggcta gagccttttc
     351  taacgcagag atgtttgcga ttgaattggt tttgtacacc aaggaaaggc
     401  aattagcagt cgatttagcc gctgaaaggg agaagacgag actggctcgt
     451  agacacccaa tgcgttctcc ggaagaaact ccggaacatt ataaattcgg
     501  tatgactgct aaggcaatgt taccggacat caacgccgta gacgttggtg
     551  atagcgagga aacttcgtcg gagtacccag tgagtctgag tgtttctggc
     601  ggagttctcc gtgaacacca cttcatctga