Sequence of DPV Citrus tristeza virus

Citrus tristeza virus p23 protein gene, complete cds.

ACC No: U42023

Dated: 2001-11-28 | Length: 630 | CRC: 1682642578

                !!NA_SEQUENCE 1.0
ID   CT42023    standard; RNA; VRL; 630 BP.
XX
AC   U42023;
XX
SV   U42023.1
XX
DT   01-JUL-1996 (Rel. 48, Created)
DT   28-NOV-2001 (Rel. 69, Last updated, Version 3)
XX
DE   Citrus tristeza virus p23 protein gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-630
RX   MEDLINE; 97189518.
RX   PUBMED; 9037736.
RA   Pappu S.S., Febres V.J., Pappu H.R., Lee R.F., Niblett C.L.;
RT   "Characterization of the 3' proximal gene of the citrus tristeza
RT   closterovirus genome";
RL   Virus Res. 47(1):51-57(1997).
XX
RN   [2]
RP   1-630
RA   Pappu S.S.;
RT   ;
RL   Submitted (05-DEC-1995) to the EMBL/GenBank/DDBJ databases.
RL   Sita S. Pappu, Plant Pathology, University of Florida, 1453 Fifield Hall,
RL   Gainesville, FL 32611-0680, USA
XX
DR   SPTREMBL; Q66259; Q66259.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .630
FT                   /db_xref="taxon:12162"
FT                   /organism="Citrus tristeza virus"
FT                   /strain="Severe stem pitting strain B220 from India"
FT                   /specific_host="Citrus spp."
FT   CDS             1. .630
FT                   /citation=[1]
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:Q66259"
FT                   /evidence=EXPERIMENTAL
FT                   /function="unknown"
FT                   /product="p23 protein"
FT                   /protein_id="AAB03203.1"
FT                   /translation="MDNTSGQTFISVNLSDESNTASTEVKTVTSEADRLEFLRKMNPFT
FT                   IDALIRKTSYQGARFRARIIGVCVDCGRKHDKGLKTERKCKVNNTQSQNEVAHMLMHDP
FT                   VKYLNKRKARAFSNAEMFAIDLVMHTKERQLAVGLAAEREKTRLARRHPMRSPEETPEH
FT                   YKFGMTAKAMLPDINAIGVGDNEDTSSEYPVSLSVSGGVLREHHFI"
XX
SQ   Sequence 630 BP; 189 A; 122 C; 162 G; 157 T; 0 other;

 U42023  Length: 630  December 21, 2001 15:59  Type: N  Check: 756  ..

       1  atggataata ctagcggaca aactttcatt tccgtgaacc tttctgatga
      51  aagcaacacg gctagtactg aagttaaaac cgtaacttct gaagcggatc
     101  gcttggaatt tttacggaaa atgaatccct ttaccatcga cgctttgata
     151  cggaaaacca gttatcaggg tgctcgcttt cgcgcgagga taataggagt
     201  gtgcgtagat tgtggtagaa agcacgataa ggggttgaag accgaacgta
     251  aatgtaaggt caacaataca caatctcaga acgaggtggc gcatatgtta
     301  atgcacgatc ccgtgaaata tttaaataaa agaaaagcta gagctttttc
     351  taacgcagag atgtttgcga tcgatttggt tatgcatacc aaagaaaggc
     401  aattagcggt tggtttggcc gctgaaaggg agaagacgag attggctcgt
     451  aggcacccga tgcgttctcc ggaggaaact ccggaacatt ataagttcgg
     501  tatgactgct aaggcaatgt taccggacat caacgctata ggcgttggtg
     551  ataacgagga cacttcgtcg gaatacccag tgagtctgag tgtttcaggc
     601  ggagttctcc gtgaacacca cttcatctga