Sequence of DPV Tomato bushy stunt virus

Tomato bushy stunt virus pepper isolate, complete genome.

ACC No: U80935

Dated: 2005-04-18 | Length: 4776 | CRC: -1448642447

                !!NA_SEQUENCE 1.0
ID   TBU80935   standard; circular genomic RNA; VRL; 4776 BP.
XX
AC   U80935;
XX
SV   U80935.1
XX
DT   25-DEC-1996 (Rel. 50, Created)
DT   18-APR-2005 (Rel. 83, Last updated, Version 6)
XX
DE   Tomato bushy stunt virus pepper isolate, complete genome.
XX
KW   .
XX
OS   Tomato bushy stunt virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Tombusvirus.
XX
RN   [1]
RP   1-4776
RX   MEDLINE; 98285798.
RX   PUBMED; 9621100.
RA   Havelda Z., Szittya G., Burgyan J.;
RT   "Characterization of the molecular mechanism of defective interfering
RT   RNA-mediated symptom attenuation in tombusvirus-infected plants";
RL   J. Virol. 72(7):6251-6256(1998).
XX
RN   [2]
RP   1-4776
RX   DOI; 10.1016/S0168-1702(00)00178-7.
RX   MEDLINE; 20473138.
RX   PUBMED; 11018282.
RA   Szittya G., Salamon P., Burgyan J.;
RT   "The complete nucleotide sequence and synthesis of infectious RNA of
RT   genomic and defective interfering RNAs of TBSV-P";
RL   Virus Res. 69(2):131-136(2000).
XX
RN   [3]
RP   1-4776
RA   Szittya G., Burgyan J.;
RT   ;
RL   Submitted (04-DEC-1996) to the EMBL/GenBank/DDBJ databases.
RL   Institute for Plant Sciences, Agricultural Biotechnology Center,
RL   Szent-Gyorgyi street 4. P.O. Box 411, Godollo H-2101, Hungary
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .4776
FT                   /db_xref="taxon:12145"
FT                   /mol_type="genomic RNA"
FT                   /organism="Tomato bushy stunt virus"
FT                   /isolate="pepper"
FT   CDS             167. .1057
FT                   /codon_start=1
FT                   /db_xref="UniProt/TrEMBL:P90340"
FT                   /note="TBSV-P ORF1"
FT                   /product="33K protein"
FT                   /protein_id="AAC32731.1"
FT                   /translation="METIKRMIWPKKEIFVGDFAIGVNRTAPVDIFQLVCRVVLRYMRT
FT                   GKIDCDSDSMTKFIVELLKTDCAAKWEWFMKRRQRGDYVIPLSIAAIPIIPLLSYATWV
FT                   RAVSVRAFGNELSFNVRVPRPSVPKKGLLLRLAAGLAFRPICALAVYATLPREKLSVFK
FT                   LRTEARAHMEDEREATDCLVVEPARELKGKDGEDLITGSRLTKVIASTGTPRRRPYAAK
FT                   IAQVARAKVGYLKNSPENRLIYQRVMIEIMDKDCVRYVDRDVILPLAIGCCFVYPDGVE
FT                   ESAALWGSQESLGVK"
FT   CDS             167. .2623
FT                   /codon_start=1
FT                   /db_xref="GOA:P89211"
FT                   /db_xref="InterPro:IPR002166"
FT                   /db_xref="InterPro:IPR007094"
FT                   /db_xref="InterPro:IPR007095"
FT                   /db_xref="UniProt/TrEMBL:P89211"
FT                   /note="TBSV-P ORF2; fusion gene of the first 2 TBSV-P ORFs;
FT                   translation product of terminator readthrough at UAG
FT                   terminator of ORF1"
FT                   /transl_except=(pos:1055. .1057,aa:OTHER)
FT                   /product="92K protein"
FT                   /protein_id="AAC32730.1"
FT                   /translation="METIKRMIWPKKEIFVGDFAIGVNRTAPVDIFQLVCRVVLRYMRT
FT                   GKIDCDSDSMTKFIVELLKTDCAAKWEWFMKRRQRGDYVIPLSIAAIPIIPLLSYATWV
FT                   RAVSVRAFGNELSFNVRVPRPSVPKKGLLLRLAAGLAFRPICALAVYATLPREKLSVFK
FT                   LRTEARAHMEDEREATDCLVVEPARELKGKDGEDLITGSRLTKVIASTGTPRRRPYAAK
FT                   IAQVARAKVGYLKNSPENRLIYQRVMIEIMDKDCVRYVDRDVILPLAIGCCFVYPDGVE
FT                   ESAALWGSQESLGVKXGGLVRLPGVVTQINRDIPSDVLLPQEVLEVRAGPPNAKDRNIF
FT                   MVAGCPSQARFLVHNHCLKNLKRGLVERVFCVERNGKLARAPQPTKGAFGRLSPFRKAV
FT                   CEKVGVAHRLGYDGFLSYYDGAKLRTYTRAVESLHITPVSERDSHLTTFVKAEKISTSK
FT                   GDPAPRVIQPRNPRYNVELGRYLRHMESKLMKAVDGVFGETTCIKGYSADEVGAIFREK
FT                   WDRFDKPVAIGLDAWRFDQHCSVEALQYEHSFYRAMYPGNKLLGKLLEWQLHNKGKGYV
FT                   PDGTITYRKEGCRMSGDINTSLGNYLLMCAMVHGYMRHLGINEFSLANCGDDCVLILER
FT                   RNLKQVQRTLPEYFLNLGYTMKVERPVFQLEEVEFDQAHPVQFQGGWKMVGNVRTAMRK
FT                   DVHCVNNIRDLATRRAWSNAQHHGGLALRAGIPVVETFYSRFKLYDTPRKHQRIDTVTN
FT                   VHKWRGSGGSYVVTPESRASFWAAFCLTGDEQLALEDRLERWEMDLFGEEGVDAHEPSI
FT                   LDSAVA"
FT   CDS             2653. .3819
FT                   /codon_start=1
FT                   /db_xref="GOA:P89212"
FT                   /db_xref="HSSP:2TBV"
FT                   /db_xref="InterPro:IPR000169"
FT                   /db_xref="InterPro:IPR000937"
FT                   /db_xref="UniProt/TrEMBL:P89212"
FT                   /note="TBSV-P ORF3"
FT                   /product="41K protein"
FT                   /protein_id="AAC32732.1"
FT                   /translation="MAMVRRNNNTGMIPVSTKQLLALGAAAGATALQGYVKNNGMAIVK
FT                   GAVYLTKREYKAVRRRGGKKQQMINHVGGTGGAIMAPVAVTRQLVGSKPKFTGRTSGSV
FT                   TVTHREYLSQVNNSTGFQVNGGIVGNLLQLNPLNGTLFSWLPAIASNFDQYTFNNVVLH
FT                   YVPLCSTTEVGRVAIYFDKDSEDPEPADRVELANYSVLKETAPWAEAMLRVPTDKIKRF
FT                   CDDSSTSDHKLIDLGQLGIATYGGAGTNAVGDIFICYSVTLYFPQPTNTLLSTRRLDLA
FT                   GALVTASGPGYLLVSRTATVLTMTFRATGTFVISGTYRCLTATTLGLAGGVNVNSITVV
FT                   DNIGADSAFFINCTVSNLPSVVTFTSTGITSATVHCVRATGQNDVSLI"
FT   CDS             3857. .4426
FT                   /codon_start=1
FT                   /db_xref="GOA:Q76S74"
FT                   /db_xref="InterPro:IPR005332"
FT                   /db_xref="UniProt/TrEMBL:Q76S74"
FT                   /note="TBSV-P ORF4"
FT                   /product="22K protein"
FT                   /protein_id="AAC32733.1"
FT                   /translation="MDTEYEQVNKPWNELYKETTLGNKLTVNVGMEDQEVPLLPSNFLT
FT                   KVRVGLSGGYITMRRIRIKIIPLVSRKAGVSGKLYLRDISDTTGRKLHCTESLDLGREI
FT                   RLTMQHLDFSVSTRSDVPIVFGFEELVSPFLEGRELFSISVRWQFGLSKNCYSLPQSKW
FT                   KVMYQEDALKVLKPSKKKASKTDSSV"
FT   CDS             3889. .4407
FT                   /codon_start=1
FT                   /db_xref="GOA:P89213"
FT                   /db_xref="HSSP:1R9F"
FT                   /db_xref="InterPro:IPR004905"
FT                   /db_xref="UniProt/TrEMBL:P89213"
FT                   /note="TBSV-P ORF5"
FT                   /product="19K protein"
FT                   /protein_id="AAC32734.1"
FT                   /translation="MERAIQGNDAREQANSERWDGGSGSSTSPFQLPDESPSWTEWRLH
FT                   NDETNSNQDNPLGFKESWGFGKVVFKRYLRYDRTEASLHRVLGSWTGDSVNYAASRFFG
FT                   VNQIGCTYSIRFRGVSVTISGGSRTLQHLCEMAIRSKQELLQLTPVEVESNVSRGCPEG
FT                   VETFEEESE"
XX
SQ   Sequence 4776 BP; 1255 A; 966 C; 1322 G; 1233 T; 0 other;

   U80935  Length: 4776  May 10, 2005 10:09  Type: N  Check: 4081  ..

       1  agaaattccc caggatttct cgacctagta cgtctacctg gtgacttgcg
      51  ctgtctgttg ctttgcgtag ggaatttctc tccaatatta ttatctttaa
     101  tttggggttt gaaggttggg tctacccttc ggggggataa attgtaactt
     151  ccaacaaata agcgacatgg agaccattaa gaggatgatc tggcctaaga
     201  aagagatttt tgtgggtgat ttcgcgatcg gagttaatag gacggcaccg
     251  gtggacattt tccaattggt gtgtcgtgtg gttctaagat acatgaggac
     301  agggaaaata gactgtgatt ctgacagcat gactaagttt atagttgaat
     351  tacttaaaac tgattgtgct gccaaatggg agtggtttat gaagagacgg
     401  cagaggggcg actatgttat ccctctatct atagccgcca tcccaatcat
     451  accgctgttg agttatgcca catgggtacg cgcagtctca gtcagggcct
     501  ttgggaatga actttcgttc aatgtcagag tacctagacc atctgtacct
     551  aagaaaggat tgctcctcag actggcggca ggcctagcgt tcagacctat
     601  atgcgcgctg gcagtgtacg ctaccctacc tagggaaaaa ctgtcggtat
     651  ttaagctgag aaccgaggca cgcgcacata tggaggatga gagagaagcg
     701  acagattgct tggtggttga gccggcacgg gaactcaagg gtaaggatgg
     751  tgaggatctc atcactggta gtagattaac taaggtgatt gcgtccacag
     801  ggacgcctcg caggaggccg tatgcagcca agatcgcaca ggttgcgaga
     851  gctaaggtgg gttaccttaa gaatagtcct gagaatagac taatctacca
     901  gcgagtgatg attgagatca tggacaaaga ctgcgtcagg tatgttgaca
     951  gggatgtcat attgccattg gctattggat gctgttttgt ctatccggat
    1001  ggagtggagg agtcggcggc actatggggt tcccaggaat cccttggtgt
    1051  caaataggga ggcctagtac gtctacctgg tgttgtaaca cagatcaatc
    1101  gagatatccc atctgatgtg ttacttcccc aggaggtgct agaggttcgt
    1151  gcaggacctc ccaatgctaa ggaccgtaat atatttatgg ttgcaggttg
    1201  cccatcacag gcacggttct tagtacataa tcactgcctg aaaaacctta
    1251  aaaggggtct tgtggagaga gtcttctgcg tagagagaaa cgggaagctc
    1301  gctcgcgctc cacaacctac caaaggagct tttggacgtc tttccccgtt
    1351  caggaaagcg gtttgtgaga aggttggggt agcccaccga cttgggtatg
    1401  atgggtttct gtcatactac gacggtgcga aactccgtac ttacacacga
    1451  gccgtggaga gtctgcatat cacacctgtt tccgagaggg atagtcattt
    1501  gactaccttc gtgaaagcag agaagatatc gacgtctaaa ggtgacccag
    1551  cacctcgggt gattcagcct cgaaacccga ggtacaatgt ggaacttgga
    1601  agatatctac ggcatatgga atccaagctg atgaaagctg ttgatggcgt
    1651  gttcggagaa acaacatgca tcaaaggata ctctgccgac gaggtgggtg
    1701  caatttttcg ggagaaatgg gataggtttg ataaacctgt agccataggt
    1751  ctcgatgcat ggaggtttga tcaacactgt tccgtggagg ctttgcaata
    1801  tgagcatagt ttctacaggg ccatgtaccc tggcaacaag cttttgggca
    1851  agttgttgga atggcaactc cataataaag gtaaaggtta tgtccctgat
    1901  gggactataa cttatcgtaa ggagggttgt cgtatgagtg gggatataaa
    1951  cacttcgttg gggaactatc tgttgatgtg tgcaatggta catgggtaca
    2001  tgcgtcattt ggggattaat gaatttagtc tggcgaactg tggggatgat
    2051  tgcgttctca ttcttgagcg caggaatctt aaacaggtgc agagaactct
    2101  gcctgagtat ttccttaatt tgggttatac catgaaggtt gagcgacctg
    2151  tatttcaatt ggaagaggtt gaatttgacc aggcacaccc agtacagttt
    2201  caagggggtt ggaagatggt gggaaatgtc cgtactgcta tgagaaaaga
    2251  cgtgcactgt gtcaataata tacgcgattt ggcgacgagg agagcttgga
    2301  gtaatgctca acatcatgga gggctagcac ttagggctgg tatacctgtg
    2351  gttgagactt tttactccag gttcaagctg tatgatacac ctcgtaagca
    2401  tcaacgcatt gacacagtca ctaatgttca taagtggcgt ggatcgggtg
    2451  ggagctatgt tgtgacccct gaatcaagag ctagcttttg ggctgctttt
    2501  tgcctcacgg gggatgagca actggctctg gaggatcgtc tggagagatg
    2551  ggagatggat ctattcggag aggagggtgt tgacgctcat gagcccagca
    2601  tccttgactc cgccgtagct tgaccaagga tacacaaacg caggatagac
    2651  acatggcaat ggtgagaaga aacaacaata cgggaatgat cccggtgagt
    2701  acgaagcaat tactggcatt gggtgcggcc gctggggcca cagccttaca
    2751  gggatatgtc aagaataatg ggatggccat cgtgaagggg gctgtctatc
    2801  tgactaaaag agagtacaaa gcagtgcgga gaagaggagg taagaaacag
    2851  cagatgatta atcatgtagg tgggacaggt ggtgctataa tggcgccggt
    2901  tgcagtcacc agacaacttg ttggtagtaa gcctaagttt actggcagga
    2951  cgtctgggtc tgtaacagtc acccaccgtg agtatctgtc acaagtgaat
    3001  aattccacag gtttccaggt taatggggga attgtcggca atttgttaca
    3051  actcaacccg ttgaatggta cattgttctc ttggttgcca gcaatagcat
    3101  ccaattttga ccagtacaca tttaacaatg ttgtgttaca ttatgtcccc
    3151  ctatgttcca ccactgaggt ggggagagtg gctatttact ttgataagga
    3201  ctcagaagat cctgagcctg ctgatagagt tgagttggcg aattacagcg
    3251  tgcttaaaga gacagcccct tgggctgaag cgatgctcag agtacccaca
    3301  gataagatta agagattttg tgatgacagt tcaacatctg atcacaagct
    3351  tatcgacctg ggtcagttgg gtattgctac atatggtggc gctgggacta
    3401  acgctgttgg ggatatcttt atctgttaca gtgttacgtt atatttccct
    3451  caacctacaa atacactcct tagtaccaga aggctcgacc ttgctggcgc
    3501  tcttgtcaca gcatccggtc cggggtacct cttggtgtct cggactgcca
    3551  ctgtcttgac gatgacattt cgtgcaactg gtacgtttgt catatccggt
    3601  acgtacaggt gccttacagc aacaacacta ggcttggcag gcggggtgaa
    3651  cgtcaatagt atcacagtag tcgacaatat aggtgctgac agtgcatttt
    3701  tcataaattg cactgtctct aacctaccat ctgtggtgac gttcacatct
    3751  accggcatca catcagccac agtacattgc gtgcgtgcaa ccggacagaa
    3801  tgatgtttct ctaatctagt gtgtcctgcg aggggcctgt tgaacaagac
    3851  cagttcatgg atactgaata cgaacaagtc aataaaccat ggaacgagct
    3901  atacaaggaa acgacgctag ggaacaagct aacagtgaac gttgggatgg
    3951  aggatcagga agttccactt ctcccttcca acttcctgac gaaagtccga
    4001  gttggactga gtggcggcta cataacgatg agacgaattc gaatcaagat
    4051  aatccccttg gtttcaagga aagctggggt ttcgggaaag ttgtatttaa
    4101  gagatatctc agatacgaca ggacggaagc ttcattgcac agagtccttg
    4151  gatcttggac gggagattcg gttaactatg cagcatctcg atttttcggt
    4201  gtcaaccaga tcggatgtac ctatagtatt cggtttcgag gagttagtgt
    4251  caccatttct ggagggtcga gaactcttca gcatctctgt gagatggcaa
    4301  ttcggtctaa gcaagaactg ctacagctta ccccagtcga agtggaaagt
    4351  aatgtatcaa gaggatgccc tgaaggtgtt gaaaccttcg aagaagaaag
    4401  cgagtaagac agactcttca gtctgagttt gcggaaacga gtgtaaatct
    4451  ggcatagcat acaggttact cttgttgggt tctagatgtt atgatgacga
    4501  gtcggtcggg ctccgcgcta ggtttggtcg cctaggggat ggagatatgg
    4551  aaagggtctc gtgtgctgtc agtcggtcga aagacgcgct tgcaacatgg
    4601  gcctataacc ggataagtca tagcaatact agccaacatg aattggattc
    4651  ctgtttacga aagttaggtg acacttgtgg aaacggacct ggacacggtt
    4701  gatctcacct tcgggggggc tatagagatc gctggaagca ctaccggaca
    4751  accggaacat tgcagcaatg cagccc