Sequence of DPV Red clover necrotic mosaic virus

Red clover necrotic mosaic virus (RCNMV) RNA2

ACC No: X08021

Dated: 2005-04-18 | Length: 1448 | CRC: 120228824

                !!NA_SEQUENCE 1.0
ID   RCNMV2     standard; genomic RNA; VRL; 1448 BP.
XX
AC   X08021;
XX
SV   X08021.1
XX
DT   20-JUL-1988 (Rel. 17, Created)
DT   18-APR-2005 (Rel. 83, Last updated, Version 3)
XX
DE   Red clover necrotic mosaic virus (RCNMV) RNA2
XX
KW   RNA2 gene.
XX
OS   Red clover necrotic mosaic virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Dianthovirus.
XX
RN   [1]
RP   1-1448
RA   Lommel S.A.;
RT   ;
RL   Submitted (03-JUL-1988) to the EMBL/GenBank/DDBJ databases.
RL   Lommel S.A., Kansas State University, Dept of Plant Pathology, Throckmorton
RL   Hall, Kansa State University, Manhattan, KS 66506.
XX
RN   [2]
RP   1-1448
RX   MEDLINE; 88335609.
RX   PUBMED; 3047682.
RA   Lommel S.A., Weston Fina M., Xiong Z., Lomonossoff G.P.;
RT   "The nucleotide sequence and gene organization of red clover necrotic
RT   mosaic virus RNA-2";
RL   Nucleic Acids Res. 16(17):8587-8602(1988).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1448
FT                   /db_xref="taxon:12267"
FT                   /mol_type="genomic RNA"
FT                   /organism="Red clover necrotic mosaic virus"
FT                   /strain="Australian"
FT   misc_feature    1. .1
FT                   /note="7'-methyl-G cap"
FT   CDS             80. .1033
FT                   /db_xref="GOA:P10838"
FT                   /db_xref="InterPro:IPR000603"
FT                   /db_xref="UniProt/Swiss-Prot:P10838"
FT                   /note="ORF for 35 kDa polypeptide (AA 1-317)"
FT                   /protein_id="CAA30822.1"
FT                   /translation="MAVHVENLSDLAKTNDGVAVSLNRYTDWKCRSGVSEAPLIPASMM
FT                   SKITDYAKTTAKGNSVALNYTHVVLSLAPTIGVAIPGHVTVELINPNVEGPFQVMSGQT
FT                   LSWSPGAGKPCLMIFSVHHQLNSDHEPFRVRITNTGIPTKKSYARCHAYWGFDVGTRHR
FT                   YYKSEPARLIELEVGYQRTLLSSIKAVEAYVQFTFDTSRMEKNPQLCTKSNVNIIPPKA
FT                   ETGSIRGIAPPLSVVPNQGRESKVLKQKGGTGSKTTKLPSLEPSSGSSSGLSMSRRSHR
FT                   NVLNSSIPIKRNQDGNWLGDHLSDKGRVTDPNPERL"
XX
SQ   Sequence 1448 BP; 422 A; 324 C; 359 G; 343 T; 0 other;

   X08021  Length: 1448  May 10, 2005 10:10  Type: N  Check: 509  ..

       1  gaaacctcgc tctataaaca gattaattga ttggaagaaa acaagatcgt
      51  aagactacca acaatacaaa gaggtttgga tggctgttca tgtggaaaat
     101  ttaagtgatt tggcaaagac aaatgatgga gtagcagtat cattgaaccg
     151  ttatactgat tggaaatgca ggtctggagt ttctgaagct cctcttatac
     201  ctgccagtat gatgagtaag atcactgact acgctaaaac tactgctaaa
     251  ggaaacagtg ttgcgcttaa ttacacccac gtagttcttt cgctagcacc
     301  gacaattggt gtggcaattc caggacacgt caccgtagaa ttgataaatc
     351  caaacgtgga aggaccgttt caagttatgt caggtcagac cttgtcgtgg
     401  tcgccaggag ctggaaagcc ctgcctgatg atattctcag tccaccacca
     451  actcaactcg gatcacgagc cttttagggt gcgaatcacg aataccggaa
     501  tcccaacgaa gaaatcgtat gcaagatgcc atgcgtattg ggggtttgac
     551  gtgggaactc gacaccgcta ttacaagtca gaaccagcgc gtctgattga
     601  gttggaagta ggttatcagc ggacgttact gtcgagcatc aaggcagtgg
     651  aagcctacgt gcagtttacc tttgacacaa gcaggatgga gaagaatcct
     701  caactgtgca ccaaatccaa tgtgaacatc atccctccca aagcagagac
     751  aggttcaatc agaggtatcg ccccgcctct cagtgttgta ccaaaccaag
     801  gacgagagtc caaggtgttg aaacagaaag gaggaactgg cagcaaaacc
     851  acgaagctgc cttcgttgga accttcttcc ggttccagtt ccggcttgag
     901  tatgagccga agatctcaca gaaatgttct gaactcatct attccgatta
     951  aacgtaacca agatggcaat tggttaggtg accacctatc tgacaagggc
    1001  cgggttaccg acccaaatcc ggaaagactc tagacgagcc ggggaagtca
    1051  gatgcctggc cactgaaaaa gtggaatctc atccagagta caaaagagaa
    1101  agagaattgc tttggcttcg gcggaagacg aaaaggttta aatacaggct
    1151  acgagttctc ctcgtagggt ctctctttct tggcctttag tgggctttgg
    1201  tttaggttcc atttctacag cgtatggacc atggatgttc ttcagcctat
    1251  cgtagtgtgt gcgatagcat tgcgttaggg gttactttcg agagatttgg
    1301  aggggttggt ccctccggtg agagaagaaa actcatccca aacaaaaaac
    1351  agggtttctg ataaccggtg cgacaatatg cccttccaag gcactgaccg
    1401  gcacggagaa aaactataat gccatgtcgt ataacggcta ggcacccc