Sequence of DPV Nicotiana tabacum Tnt1 virus

Tobacco DNA for retroviral-like transposon Tnt 1-94

ACC No: X13777

Dated: 2002-07-07 | Length: 5334 | CRC: -1153335551

                !!NA_SEQUENCE 1.0
ID   NTTNT194   standard; genomic DNA; PLN; 5334 BP.
XX
AC   X13777;
XX
SV   X13777.1
XX
DT   22-APR-1989 (Rel. 19, Created)
DT   07-JUL-2002 (Rel. 72, Last updated, Version 7)
XX
DE   Tobacco DNA for retroviral-like transposon Tnt 1-94
XX
KW   endonuclease; long terminal repeat; protease; retroposon;
KW   reverse transcriptase; transposon; transposon Tnt 1-94;
KW   unidentified reading frame.
XX
OS   Nicotiana tabacum (common tobacco)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliophyta; eudicotyledons; core eudicots; asterids;
OC   lamiids; Solanales; Solanaceae; Nicotiana.
XX
RN   [1]
RP   1-5334
RA   Rouze P.;
RT   ;
RL   Submitted (16-DEC-1988) to the EMBL/GenBank/DDBJ databases.
RL   Rouze P., Institut National de la Recherche Agronomique, Lab de Biologie
RL   Cellulaire, INRA, Centre de Versailles, 78026 Versailles Cedex, France.
XX
RN   [2]
RX   DOI; 10.1038/337376a0.
RX   MEDLINE; 89097311.
RX   PUBMED; 2536143.
RA   Grandbastien M.A., Spielmann A., Caboche M.;
RT   "Tnt1, a mobile retroviral-like transposable element of tobacco, isolated
RT   by plant cell genetics";
RL   Nature 337(6205):376-380(1989).
XX
RN   [3]
RP   1-5334
RX   MEDLINE; 93275734.
RX   PUBMED; 8389038.
RA   Casacuberta J.M., Grandbastien M.A.;
RT   "Characterization of LTR sequences involved in the protoplast specific
RT   expression of the tobacco Tnt1 retrotransposon";
RL   Nucleic Acids Res. 21(9):2087-2093(1993).
XX
CC   Data kindly reviewed (02-may-1989) by Grandbastian M.A.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .5334
FT                   /db_xref="taxon:4097"
FT                   /mol_type="genomic DNA"
FT                   /organism="Nicotiana tabacum"
FT                   /clone_lib="lambda NM1149"
FT                   /clone="LNM94"
FT                   /isolate="h9-Nia4"
FT   repeat_region   1. .5334
FT                   /transposon="Tnt 1-94"
FT   LTR             1. .610
FT   CDS             692. .4678
FT                   /db_xref="GOA:P10978"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR001995"
FT                   /db_xref="UniProt/Swiss-Prot:P10978"
FT                   /note="ORF"
FT                   /protein_id="CAA32025.1"
FT                   /translation="MSGVKYEVAKFNGDNGFSTWQRRMRDLLIQQGLHKVLDVDSKKPD
FT                   TMKAEDWADLDERAASAIRLHLSDDVVNNIIDEDTARGIWTRLESLYMSKTLTNKLYLK
FT                   KQLYALHMSEGTNFLSHLNVFNGLITQLANLGVKIEEEDKAILLLNSLPSSYDNLATTI
FT                   LHGKTTIELKDVTSALLLNEKMRKKPENQGQALITEGRGRSYQRSSNNYGRSGARGKSK
FT                   NRSKSRVRNCYNCNQPGHFKRDCPNPRKGKGETSGQKNDDNTAAMVQNNDNVVLFINEE
FT                   EECMHLSGPESEWVVDTAASHHATPVRDLFCRYVAGDFGTVKMGNTSYSKIAGIGDICI
FT                   KTNVGCTLVLKDVRHVPDLRMNLISGIALDRDGYESYFANQKWRLTKGSLVIAKGVARG
FT                   TLYRTNAEICQGELNAAQDEISVDLWHKRMGHMSEKGLQILAKKSLISYAKGTTVKPCD
FT                   YCLFGKQHRVSFQTSSERKLNILDLVYSDVCGPMEIESMGGNKYFVTFIDDASRKLWVY
FT                   ILKTKDQVFQVFQKFHALVERETGRKLKRLRSDNGGEYTSREFEEYCSSHGIRHEKTVP
FT                   GTPQHNGVAERMNRTIVEKVRSMLRMAKLPKSFWGEAVQTACYLINRSPSVPLAFEIPE
FT                   RVWTNKEVSYSHLKVFGCRAFAHVPKEQRTKLDDKSIPCIFIGYGDEEFGYRLWDPVKK
FT                   KVIRSRDVVFRESEVRTAADMSEKVKNGIIPNFVTIPSTSNNPTSAESTTDEVSEQGEQ
FT                   PGEVIEQGEQLDEGVEEVEHPTQGEEQHQPLRRSERPRVESRRYPSTEYVLISDDREPE
FT                   SLKEVLSHPEKNQLMKAMQEEMESLQKNGTYKLVELPKGKRPLKCKWVFKLKKDGDCKL
FT                   VRYKARLVVKGFEQKKGIDFDEIFSPVVKMTSIRTILSLAASLDLEVEQLDVKTAFLHG
FT                   DLEEEIYMEQPEGFEVAGKKHMVCKLNKSLYGLKQAPRQWYMKFDSFMKSQTYLKTYSD
FT                   PCVYFKRFSENNFIILLLYVDDMLIVGKDKGLIAKLKGDLSKSFDMKDLGPAQQILGMK
FT                   IVRERTSRKLWLSQEKYIERVLERFNMKNAKPVSTPLAGHLKLSKKMCPTTVEEKGNMA
FT                   KVPYSSAVGSLMYAMVCTRPDIAHAVGVVSRFLENPGKEHWEAVKWILRYLRGTTGDCL
FT                   CFGGSDPILKGYTDADMAGDIDNRKSSTGYLFTFSGGAISWQSKLQKCVALSTTEAEYI
FT                   AATETGKEMIWLKRFLQELGLHQKEYVVYCDSQSAIDLSKNSMYHARTKHIDVRYHWIR
FT                   EMVDDESLKVLKISTNENPADMLTKVVPRNKFELCKELVGMHSN"
FT   misc_feature    1385. .1426
FT                   /note="nucleic acid binding domain"
FT   misc_feature    1580. .1588
FT                   /note="protease active site"
FT   LTR             4725. .5334
XX
SQ   Sequence 5334 BP; 1661 A; 891 C; 1314 G; 1468 T; 0 other;

   X13777  Length: 5334  May 9, 2005 17:26  Type: N  Check: 2189  ..

       1  tgatgatgtc catctcattg aagaagtatt aggcatgtgc ctaataagag
      51  ttttctttgg tttggtagcc aaccttgttg acttggtttg gttggtagcc
     101  aaccttgttg aatccttgtt ggattggtag ccaactttgt tgaattgtga
     151  aaaatgtgtg taaattgtca aatattgtag gctttagagg gtgaagcttt
     201  ggctataaaa ggagagcttc aactctcatt tcttcacacc aacaaagaga
     251  gaaagaaaga gtgaggtttc acagacaagg tataagaaaa tagtctgtga
     301  ggaaaataga gagtgagcga tattgtagtg aggtgggaat atcaaaagag
     351  ggttatttct tttgagtgtt gtagtggtct ttggagtatt tacctccgac
     401  ctacaaagtg taaaattcct tactatagtg atatcagttg ctcctctcgg
     451  ggtcgtggtt ttttttccct tattcagaag ggttttccac gtaaaaatct
     501  tggtgtcatt gttactcttt tattcttgtt aattaccgta tctcggtgct
     551  acattattat tccgctttat taccgtgaat attattttgg taaggggttt
     601  attcccaaca actggtatca gagcacaggt tctgctcgtt cactgaaata
     651  ctattcactg tcggtagtac tatacttggt gaaaaataaa aatgtctgga
     701  gtaaagtacg aggtagcaaa attcaatgga gataacggtt tctcaacatg
     751  gcaaagaagg atgagagatc tgctcatcca acaaggatta cacaaggttc
     801  tagatgttga ttccaaaaag cctgatacca tgaaagctga ggattgggct
     851  gacttggatg aaagagctgc tagtgcaatc aggttgcact tatcagatga
     901  tgtggtaaat aacatcattg atgaagacac tgcacgtgga atttggacaa
     951  ggttggaaag cctatacatg tccaaaacgc tgacaaataa attgtacctg
    1001  aagaagcagt tatacgccct acacatgagt gaaggtacga attttttgtc
    1051  acatttaaat gtgtttaacg gactaatcac acagcttgcc aacctcggag
    1101  tgaaaatcga ggaagaagat aaagccatct tgctattgaa ctcgttgcca
    1151  tcttcgtacg ataatttggc aacaaccatc ctgcacggta agactactat
    1201  tgagttgaaa gatgtcacat cggctcttct actcaatgag aagatgagaa
    1251  agaagcctga aaatcaagga caggctctca tcacagaagg tagaggcagg
    1301  agttatcaaa ggagttcgaa caactatggt agatccggag ctcgtgggaa
    1351  gtcaaagaat cgatccaaat caagagtcag aaattgctac aactgtaatc
    1401  aaccaggtca cttcaaaaga gattgcccaa atccaaggaa gggcaaaggt
    1451  gaaaccagtg gccagaagaa tgacgacaac acagccgcca tggtgcaaaa
    1501  taatgataat gttgtcctct ttataaatga ggaagaggaa tgcatgcacc
    1551  tgtcaggtcc agagtcggaa tgggtggttg acacagcggc atctcaccat
    1601  gccacaccgg taagagatct tttttgcaga tatgtagcag gtgatttcgg
    1651  cacagtgaaa atgggtaaca caagttactc aaagattgcg gggattggtg
    1701  acatttgtat caagacaaat gtcggatgca cattggttct aaaggatgtg
    1751  cggcatgtac ctgatttgcg gatgaacttg atctcgggaa ttgctttaga
    1801  ccgagatgga tacgagagtt attttgcaaa tcaaaagtgg agactcacta
    1851  agggatcatt ggtgattgca aagggagttg ctcgtggcac gttgtacagg
    1901  acaaatgcag aaatatgcca aggtgaattg aacgcggcac aagatgagat
    1951  ttctgtagat ttatggcaca aaagaatggg tcatatgagc gagaagggat
    2001  tgcagattct tgccaagaaa tcactcattt cttatgccaa aggtacaact
    2051  gtaaaacctt gtgactactg tttatttggt aagcagcata gagtctcatt
    2101  tcagacatcg tctgaaagaa aattgaatat acttgattta gtatattctg
    2151  atgtttgcgg cccaatggaa attgaatcaa tgggcggtaa caaatatttt
    2201  gttactttta ttgatgatgc ttcacgaaaa ttatgggttt atattttgaa
    2251  aaccaaagat caggtgtttc aagttttcca gaagtttcat gctctagtag
    2301  aaagggagac gggtcgaaag ctaaagcgtc tccgaagtga caatggaggt
    2351  gagtacactt caagggaatt tgaagagtat tgttcaagtc atgggatcag
    2401  acatgaaaag acagttcctg gaaccccaca gcacaatggc gtagccgaga
    2451  ggatgaaccg caccattgtg gagaaggtga gaagcatgct cagaatggct
    2501  aaactgccta agtcattctg gggtgaagca gttcagacag cctgttacct
    2551  gatcaatagg agtccatcag ttccgttggc gtttgaaatc ccagagagag
    2601  tctggaccaa caaggaggtg tcctactcgc atctgaaggt gttcggttgc
    2651  agagcttttg cacatgtacc aaaagagcag agaacaaagc tggatgataa
    2701  atctattccc tgcatattta tcggatatgg agatgaagag ttcgggtaca
    2751  gactgtggga tcctgtaaag aagaaggtca tcagaagtag agatgtagtc
    2801  ttccgagaaa gtgaagttag aactgctgct gatatgtcag aaaaggtgaa
    2851  gaatggtata attcctaact ttgttactat tccttctact tctaacaatc
    2901  ccacaagtgc agaaagtacg accgacgagg tttccgagca gggggagcaa
    2951  cctggtgagg ttattgagca gggggagcaa cttgatgaag gtgtcgagga
    3001  agtggagcac cccactcagg gagaagaaca acatcaacct ctgaggagat
    3051  cagagaggcc aagggtagag tcacgcaggt acccttccac agagtatgtc
    3101  ctcatcagtg atgataggga gccagaaagt cttaaggagg tgttgtccca
    3151  tccagaaaag aaccagttga tgaaagctat gcaagaagag atggaatctc
    3201  tccagaaaaa tggcacatac aagctggttg aacttccaaa gggtaaaaga
    3251  ccactcaaat gcaaatgggt ctttaaactc aagaaagatg gagattgcaa
    3301  gctggtcaga tacaaagctc gattggtggt taaaggcttc gaacagaaga
    3351  aaggtattga ttttgacgaa attttctccc ccgttgttaa aatgacttct
    3401  attcgaacaa ttttgagctt agcagctagc ctagatcttg aagtggagca
    3451  gttggatgtg aaaactgcat ttcttcatgg agatttggaa gaggagattt
    3501  atatggagca accagaagga tttgaagtag ctggaaagaa acacatggtg
    3551  tgcaaattga ataagagtct ttatggattg aagcaggcac caaggcagtg
    3601  gtacatgaag tttgattcat tcatgaaaag tcaaacatac ctaaagacct
    3651  attctgatcc atgtgtatac ttcaaaagat tttctgagaa taactttatt
    3701  atattgttgt tgtatgtgga tgacatgcta attgtaggaa aagacaaggg
    3751  gttgatagca aagttgaaag gagatctgtc caagtcattt gatatgaagg
    3801  acttgggccc agcacaacaa attctaggga tgaagatagt tcgagagaga
    3851  acaagtagaa agttgtggct atctcaggag aagtacattg aacgtgtact
    3901  agaacgcttc aacatgaaga atgctaagcc agtcagcaca cctcttgctg
    3951  gtcatctaaa gttgagtaaa aagatgtgtc ctacaacagt ggaagagaaa
    4001  gggaacatgg ctaaagttcc ttattcttca gcagtcggaa gcttgatgta
    4051  tgcaatggta tgtactagac ctgatattgc tcacgcagtt ggtgttgtca
    4101  gcaggtttct tgaaaatcct ggaaaggaac attgggaagc agtcaagtgg
    4151  atactcaggt acctgagagg taccacggga gattgtttgt gctttggagg
    4201  atctgatcca atcttgaagg gctatacaga tgctgatatg gcaggtgaca
    4251  ttgacaacag aaaatccagt actggatatt tgtttacatt ttcaggggga
    4301  gctatatcat ggcagtctaa gttgcaaaag tgcgttgcac tttcaacaac
    4351  tgaagcagag tacattgctg ctacagaaac tggcaaggag atgatatggc
    4401  tcaagcgatt ccttcaagag cttggattgc atcagaagga gtatgtcgtc
    4451  tattgtgaca gtcaaagtgc aatagacctt agcaagaact ctatgtacca
    4501  tgcaaggacc aaacacattg atgtgagata tcattggatt cgagaaatgg
    4551  tagatgatga atctctaaaa gtcttgaaga tttctacaaa tgagaatccc
    4601  gcagatatgc tgaccaaggt ggtaccaagg aacaagttcg agctatgcaa
    4651  agaacttgtc ggcatgcatt caaactagaa gacagtgcta cctcctctgg
    4701  atgaatgaga ctggaggggg agattgatga tgtccatctc attgaagaag
    4751  tattaggcat gtgcctaata agagttttct ttggtttggt agccaacctt
    4801  gttgacttgg tttggttggt agccaacctt gttgaatcct tgttggattg
    4851  gtagccaact ttgttgaatt gtgaaaaatg tgtgtaaatt gtcaaatatt
    4901  gtaggcttta gagggtgaag ctttggctat aaaaggagag cttcaactct
    4951  catttcttca caccaacaaa gagagaaaga aagagtgagg tttcacagac
    5001  aaggtataag aaaatagtct gtgaggaaaa tagagagtga gcgatattgt
    5051  agtgaggtgg gaatatcaaa agagggttat ttcttttgag tgttgtagtg
    5101  gtctttggag tatttacctc cgacctacaa agtgtaaaat tccttactat
    5151  agtgatatca gttgctcctc tcggggtcgt ggtttttttt cccttattca
    5201  gaagggtttt ccacgtaaaa atcttggtgt cattgttact cttttattct
    5251  tgttaattac cgtatctcgg tgctacatta ttattccgct ttattaccgt
    5301  gaatattatt ttggtaaggg gtttattccc aaca