Sequence of DPV Cymbidium ringspot virus

Cymbidium ringspot tombusvirus RNA

ACC No: X15511

Dated: 2005-04-18 | Length: 4733 | CRC: 1377304006

                !!NA_SEQUENCE 1.0
ID   CRTV1      standard; genomic RNA; VRL; 4733 BP.
XX
AC   X15511;
XX
SV   X15511.1
XX
DT   23-NOV-1989 (Rel. 21, Created)
DT   18-APR-2005 (Rel. 83, Last updated, Version 7)
XX
DE   Cymbidium ringspot tombusvirus RNA
XX
KW   .
XX
OS   Cymbidium ringspot virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Tombusvirus.
XX
RN   [1]
RP   1-4733
RA   Grieco F.;
RT   ;
RL   Submitted (08-JUN-1989) to the EMBL/GenBank/DDBJ databases.
RL   Grieco F., Centro di Studio sui virus e le virosi delle colture ,
RL   mediterranee c/o dip. di patol. vegetale - universita, di bari , Via
RL   Amendola n 165/A 70126 Bari, Italy.
XX
RN   [2]
RP   1-4733
RX   MEDLINE; 89366663.
RX   PUBMED; 2771646.
RA   Grieco F., Burgyan J., Russo M.;
RT   "The nucleotide sequence of cymbidium ringspot virus RNA.";
RL   Nucleic Acids Res. 17(15):6383-6383(1989).
XX
CC   Data kindly reviewed (11-SEP-1989) by Grieco F.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .4733
FT                   /db_xref="taxon:12144"
FT                   /mol_type="genomic RNA"
FT                   /organism="Cymbidium ringspot virus"
FT   CDS             161. .2617
FT                   /db_xref="GOA:Q9WJD6"
FT                   /db_xref="InterPro:IPR002166"
FT                   /db_xref="InterPro:IPR007094"
FT                   /db_xref="InterPro:IPR007095"
FT                   /db_xref="UniProt/TrEMBL:Q9WJD6"
FT                   /note="translated region"
FT                   /note="readthrough stop-codon"
FT                   /transl_except=(pos:1049. .1051,aa:OTHER)
FT                   /protein_id="CAB38439.1"
FT                   /translation="METIKRLIWPKKEIFVGDFAIGVNRTVPVDVFQLVCRVVLRYMRT
FT                   GKIECESDSLSKFVVELLKTDCAAKWEWFMKRRQGGDYIVPLSIATIPLMPLLSCTTSV
FT                   RAVSVGVLGCGFSSNIPIPRLSVPRKGLLLRLAAGLALAPICALAVYATLPREKLSVYK
FT                   LRTEARTHMEDEKEATDCLVVESARELKGKDGEDLLTGSRMTKVVASTGRRRRTPYAAK
FT                   VAQVARAKVGYLRNTPENRLIYQRVIIEIMDKDCVRYVDRDVILPMAIGCCFVYQDGVE
FT                   ESAALWGSQDSLGVKXGGLVRLPGVVTQINRDIPSDVLLPQEVLEVRTGPPIAKDRNIF
FT                   MVAGCPSQARFLVHNHCLKNLKRGLVERVFCVEKDGKLTRTPQPTKGSFGRLSPFRKAV
FT                   CEKVGVAHRLGYDGFLSYYSGAKLRTYTRAVESLHITPVSERDSHLTTFVKAEKISTSK
FT                   GDPAPRVIQPRNPRYNVELGRYLRHMESKLMKAVDDVFGETTCIKGYTADEVGAIFRRK
FT                   WDRFDKPVAIGLDASRFDQHCSVEALQYEHSFYRALYPGNKLLSKLLEWQLHNKGKGYV
FT                   PDGTITYKKEGCRMSGDINTSLGNYLLMCAMVHGYMRHLGINEFSLANCGDDCVLIIER
FT                   RNLKRVQGTLPGYFLNLGYTMKVESPVFQLEEVEFCQAHPVQFQGGWKMVRNVRTAMSK
FT                   DVHCVNNIRDLATRRAWSNAQHHGGLALSAGIPVVERFYSRFPLYDMPVKHQRIDTVTN
FT                   VHKWRGSGGNYHVTPESRASFWAAFGLTGDEQVALEDRLDRWEMDLFGREGVDAHEPSI
FT                   LDSAVA"
FT   CDS             161. .1051
FT                   /db_xref="GOA:P17459"
FT                   /db_xref="UniProt/Swiss-Prot:P17459"
FT                   /note="translated region"
FT                   /protein_id="CAA33532.1"
FT                   /translation="METIKRLIWPKKEIFVGDFAIGVNRTVPVDVFQLVCRVVLRYMRT
FT                   GKIECESDSLSKFVVELLKTDCAAKWEWFMKRRQGGDYIVPLSIATIPLMPLLSCTTSV
FT                   RAVSVGVLGCGFSSNIPIPRLSVPRKGLLLRLAAGLALAPICALAVYATLPREKLSVYK
FT                   LRTEARTHMEDEKEATDCLVVESARELKGKDGEDLLTGSRMTKVVASTGRRRRTPYAAK
FT                   VAQVARAKVGYLRNTPENRLIYQRVIIEIMDKDCVRYVDRDVILPMAIGCCFVYQDGVE
FT                   ESAALWGSQDSLGVK"
FT   CDS             2629. .3771
FT                   /db_xref="GOA:Q66226"
FT                   /db_xref="HSSP:2TBV"
FT                   /db_xref="InterPro:IPR000937"
FT                   /db_xref="UniProt/TrEMBL:Q66226"
FT                   /note="translated region"
FT                   /protein_id="CAA33533.1"
FT                   /translation="MAMTTTNNNRAMTRAAKQALPALGALATSGMGQQLFMSGVNYAIE
FT                   KGKQFVPNRRGGKKNRNTDMVAHPGALSGSMAAPVAISRIVRGSKPRFIRSKGSVTITH
FT                   RELVGQFNSSSALVVNGGITGNLYKINPANAVLFPWLQTLASNFDQYMFNTLRLQYVPM
FT                   CASTETGRVAIYFDKDSQDLEPVDRIELANMRHLTETAPWCEGSLRVPVDSVKRFMNDN
FT                   STVDPKLIDLGQVGLATYGGPGTNAVGDLFIHYTVTFYEPQPSSGLTSTLQTGTGSANA
FT                   GPTLVAVATTATTTTVTFRSPGTYLVSMVQRATTFTGVTPIALTFNSNTNTTAAGTNYS
FT                   ANYNVTVPVPGAQMRFVGTGFGNYTLQVTRAKITNAATLL"
FT   CDS             3813. .4382
FT                   /db_xref="GOA:Q66227"
FT                   /db_xref="InterPro:IPR005332"
FT                   /db_xref="UniProt/TrEMBL:Q66227"
FT                   /note="translated region"
FT                   /protein_id="CAA33534.1"
FT                   /translation="MDTEYQQVNKPWNELYKEVTLGNKLTVNVGMEEEEVLLLPSNFPT
FT                   KVRVSMSGGYITVRRVRIRIIPLVSRKAGVSGKLYLRDISDTTGQKLHCTELLDLGKEI
FT                   RLTMPHLDFSVSAKSDVPIAFGFEELVSPFREGRELFSVSLRWQLGLSAQCYSLPPANV
FT                   KVMYQEDALKALKPSKKKASRTDSSV"
FT   CDS             3845. .4363
FT                   /db_xref="GOA:P17457"
FT                   /db_xref="HSSP:1R9F"
FT                   /db_xref="InterPro:IPR004905"
FT                   /db_xref="UniProt/Swiss-Prot:P17457"
FT                   /note="translated region"
FT                   /protein_id="CAA33535.1"
FT                   /translation="MERAIQGSDVREQADSECWDGGGGGTTSPFKLPDESPSLHEWRLH
FT                   HSEESENKDNPLGFKESWSFGKVVFKRYLRYDGAETSLHRALGSWERDSVNDAASRFLG
FT                   LSQIGCTYSIRFRGTRLTLSGGSGTLQRLIEMAIRTKRTMLQPTPSEREGNVSRRRPEG
FT                   TEAFKEESE"
XX
SQ   Sequence 4733 BP; 1236 A; 1045 C; 1319 G; 1132 T; 1 other;

   X15511  Length: 4733  May 10, 2005 10:10  Type: N  Check: 9939  ..

       1  ngaaatcctc caggacacct cgacctaggt tgtgtatccg gtgatttgcg
      51  tactgttgct ttgcgtagag gatttctctc ctgttcacta catatcaggg
     101  gtttgaaggc agggtctacc tttcgggggg ataaattgta acttcctgca
     151  aataagcaaa atggagacca tcaagagatt aatctggcct aagaaagaaa
     201  tttttgtagg cgatttcgcg atcggtgtta ataggacggt accggtggat
     251  gtcttccaat tggtgtgccg tgttgtgctg agatatatga ggacagggaa
     301  aatagagtgt gagtcagaca gtctgtctaa gttcgttgtg gagttattaa
     351  agacagattg tgctgctaag tgggaatggt ttatgaagag acggcagggg
     401  ggtgattaca tcgtccctct atctatagcc accatccctc tcatgccgct
     451  gttgagttgt accacctcgg tacgcgcagt ctcagtcggg gttttgggtt
     501  gtgggtttag ctccaatatc ccaatacctc gtctatctgt gccaaggaaa
     551  gggttgctcc tcagactggc ggccggccta gcgttagctc ctatatgcgc
     601  gctggccgtg tacgctaccc tgcccaggga aaaactgtcc gtgtataagc
     651  taaggacgga ggcacgcaca cacatggagg acgagaagga agcgacggat
     701  tgtttagtgg tggagtcggc tcgtgagctc aagggtaagg atggtgagga
     751  tctgctcact ggtagtagaa tgaccaaggt tgtggcttcg acaggacgtc
     801  gtcgcaggac accatatgca gcgaaagttg cacaggtggc acgtgccaag
     851  gttgggtacc tcaggaacac tcctgagaat aggctgatct accagagggt
     901  aatcattgaa atcatggaca aagattgcgt caggtatgtt gacagggatg
     951  tcatattgcc aatggctatt ggatgctgct ttgtgtacca ggatggagtg
    1001  gaggagtcgg cggcactttg ggggtcacag gactccctgg gtgtgaaata
    1051  gggaggccta gtgcgtctac ctggggttgt gacacagatc aatcgagata
    1101  tcccatctga tgtgttactt cctcaggagg tgctagaggt tcgcacagga
    1151  cctcccatag ctaaggaccg taatatattt atggttgcag gttgcccatc
    1201  acaggcacgg ttcttagttc ataatcactg cctgaaaaac cttaaaaggg
    1251  gtcttgtgga gagggttttc tgcgtcgaga aggacggtaa actcactcgc
    1301  actccacaac ctaccaaagg atcctttgga cgtctttccc cgttcaggaa
    1351  agcagtttgt gagaaggttg gggtggccca tcgcttaggg tatgacgggt
    1401  tcctgtcata ctacagtggt gcgaaactcc gtacttacac gcgagctgtg
    1451  gagagtctgc atatcactcc tgtttcagag agggatagtc atctgactac
    1501  cttcgtgaaa gcagagaaga tatcgacgtc taagggtgac ccagcaccta
    1551  gggtgataca gcctcgaaac cctaggtaca atgtggaact tggaagatat
    1601  ctacggcata tggaatccaa actaatgaaa gctgttgatg acgttttcgg
    1651  cgaaacgacg tgcatcaaag gttatacagc tgatgaggta ggcgcaatct
    1701  tcaggaggaa gtgggatagg ttcgataaac ctgttgccat tggtctcgac
    1751  gcgtctagat ttgatcaaca ctgttccgtt gaagcgttgc aatatgagca
    1801  tagcttctac agggccttgt accctggcaa caaactcttg agtaagttgt
    1851  tggaatggca gctccataac aaaggtaaag gttatgtccc tgatggaacc
    1901  ataacttaca agaaggaggg ctgtcgtatg agtggggata taaatacctc
    1951  gttgggcaat tacctgctga tgtgcgcgat ggtacatggg tacatgcgtc
    2001  acttggggat aaatgagttt agtctggcaa actgcgggga tgactgcgtt
    2051  ttgattatcg agcgcaggaa tcttaagcgg gtacagggaa cacttcctgg
    2101  ttatttccta aatctaggtt atacaatgaa ggtggaatcc cctgtatttc
    2151  aattggaaga ggttgaattc tgccaggcac accccgtaca gtttcagggc
    2201  ggttggaaga tggtcagaaa tgtccgcaca gccatgagca aagatgtcca
    2251  ctgcgttaac aatatacgcg atctggcaac aaggagggct tggagtaatg
    2301  cccaacacca tggtgggttg gcgcttagcg ctggtatacc tgtggttgaa
    2351  aggttttact ctaggtttcc tctgtatgac atgcccgtca aacatcagcg
    2401  tattgacaca gtgacaaacg tacataaatg gcgcggatca ggtgggaact
    2451  accatgtgac cccggagtct agagctagct tttgggcggc atttggactc
    2501  acgggggatg aacaggtggc ccttgaggat cgtctggata gatgggagat
    2551  ggatctattt ggaagagagg gtgttgacgc tcatgagccc agcatccttg
    2601  attccgccgt agcttgacca aatacacaat ggcaatgaca actaccaaca
    2651  acaatcgggc gatgacccga gcagcaaaac aagcgttacc ggcattgggt
    2701  gctctagcca cctccggtat gggacagcaa ttatttatga gcggggtgaa
    2751  ctacgctata gagaaaggga aacaattcgt acccaacagg cgtggaggga
    2801  agaagaatag gaatacagac atggttgcgc atccgggcgc cctttcaggg
    2851  agcatggccg caccggtggc aatctctagg attgtcaggg gatcaaaacc
    2901  ccggtttatc aggagtaaag gttctgtcac catcacacac cgagaattgg
    2951  tgggtcagtt caatagctcc tcggctttgg tggttaatgg gggaatcacg
    3001  gggaacctgt acaagattaa tccggctaat gccgtcttgt tcccctggtt
    3051  gcaaacattg gcgtctaatt tcgaccagta catgttcaac acactccgtc
    3101  tccagtacgt gccaatgtgt gcaagcaccg agactgggag ggtggctatc
    3151  tactttgaca aagattctca ggatctagaa ccagtagatc gcatcgaact
    3201  agcaaacatg cgacacctta cagagaccgc cccttggtgc gagggctctc
    3251  tgcgggtgcc agtggacagc gtcaagagat ttatgaatga caattccacc
    3301  gtcgatccaa agctgataga cttgggccag gttgggctgg cgacgtatgg
    3351  agggcccggg acaaacgcag tgggtgactt attcatccac tacacagtaa
    3401  ccttctacga accgcaaccg tcctcaggtt tgacgtctac gctacaaaca
    3451  gggactggtt cagctaacgc tgggcctacc ctggttgctg tggctaccac
    3501  agccacgacg actaccgtga cgttcagatc tccaggtaca tacctagtct
    3551  caatggtgca aagggctaca accttcacgg gagtaacgcc cattgccctt
    3601  actttcaact ccaatacgaa caccaccgcg gctggtacca attactcagc
    3651  caattacaat gtgactgtac ccgtgcctgg tgcacagatg cggtttgtag
    3701  ggaccggctt cggtaactac accttgcagg taacacgcgc caaaatcaca
    3751  aatgctgcaa cacttctgta gttgcattgc acaggaaggg gcttcttgaa
    3801  cctaaccatt tcatggacac tgaataccaa caagttaata aaccatggaa
    3851  cgagctatac aaggaagtga cgttagggaa caagctgaca gtgaatgttg
    3901  ggatggagga ggaggaggta ctacttctcc cttcaaactt cccgacgaaa
    3951  gtccgagtct ccatgagtgg aggctacatc acagtgagga gagtgagaat
    4001  aaggataatc cccttggttt caaggaaagc tggagtttcg ggaaagttgt
    4051  atttaagaga tatctcagat acgacggggc agaaacttca ttgcacagag
    4101  ctcttggatc ttgggaaaga gattcggtta acgatgccgc atctagattt
    4151  ctcggtctca gccaaatcgg atgtacctat agcattcggt ttcgaggaac
    4201  tcgtctcacc ctttcgggag ggtcgggaac tcttcagcgt ctcattgaga
    4251  tggcaattag gactaagcgc acaatgttac agcctacccc cagcgaacgt
    4301  gaaggtaatg tatcaagaag acgccctgaa ggcactgaag ccttcaaaga
    4351  agaaagcgag taggacagac tcttcagtct aggttggagg aagcaggaga
    4401  acactgcttg agggtacagg ttactcttag tgagactagg ttcgtgtgat
    4451  gacgagtcag gtcgggctcc gcgctgggtt tggtcaccca ggggatggag
    4501  atatggaaag gatctcgtgc gctataagtc taacgaaagt tgagcttgca
    4551  acatgggtct atgcctgaat aagtcacgtg agttgccacc actatgaata
    4601  ggatttttgt tcacgactag cggagaacat ttgtggaaac caaccaagac
    4651  acggttgatc tcacccttcg ggggggctat agagatcgct ggaagcacta
    4701  ccggacaacc ggaacattgc agcaatgcag ggg