Sequence of DPV Artichoke mottled crinkle virus

Artichoke Mottled Crinkle Virus complete genome

ACC No: X62493

Dated: 2005-04-18 | Length: 4789 | CRC: 260564894

                !!NA_SEQUENCE 1.0
ID   AMCVCG     standard; genomic RNA; VRL; 4789 BP.
XX
AC   X62493;
XX
SV   X62493.1
XX
DT   29-MAY-1992 (Rel. 32, Created)
DT   18-APR-2005 (Rel. 83, Last updated, Version 7)
XX
DE   Artichoke Mottled Crinkle Virus complete genome
XX
KW   genomic RNA.
XX
OS   Artichoke mottled crinkle virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Tombusvirus.
XX
RN   [1]
RX   MEDLINE; 94292901.
RX   PUBMED; 8021582.
RA   Tavazza M., Lucioli A., Calogero A., Pay A., Tavazza R.;
RT   "Nucleotide sequence, genomic organization and synthesis of infection
RT   transcripts from full-length clone of artichoke mottle crinkle virus";
RL   J. Gen. Virol. 75:1515-1524(1994).
XX
RN   [2]
RP   1-4789
RA   Tavazza M.;
RT   ;
RL   Submitted (07-OCT-1991) to the EMBL/GenBank/DDBJ databases.
RL   M. Tavazza, E N E A Dip. Sviluppo e Ricerche Agroindustriali, Div
RL   Ingegneria Genetica CP, Via Anguillarese 301, 00060 Santa Maria di
RL   Galeria-Roma, ITALY
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .4789
FT                   /db_xref="taxon:12142"
FT                   /mol_type="genomic RNA"
FT                   /organism="Artichoke mottled crinkle virus"
FT                   /clone_lib="Oligo dT and random primed cDNA library in pUC9
FT                   clone(s)"
FT                   /isolate="AMCV-Bari Dr.Gallitelli isolate"
FT                   /map="complete genome"
FT   CDS             180. .1070
FT                   /db_xref="UniProt/TrEMBL:Q65014"
FT                   /product="protein of 33 kDa"
FT                   /protein_id="CAA44355.1"
FT                   /translation="METIKSWICPKKEIFVGDFAIGVNRKVPVDIFQLVCRVVLRYMRT
FT                   GKIECDSDSMTKFLVELLKTDCAAKWEWFMKRRQRGDYVIPLSIAALPIVPLLSYATRA
FT                   RAVSVKAFGNELSLNVRVPRPSVPKKGLLLRLAAGLALAPICALAMYATLPREKLSVFK
FT                   LRTEARAHMEDEREATDCLVVEPARELKGKDGEDLLTGSRMTKVVASTGRPRRRPYAAK
FT                   IAQVARAKVGYLKNSPENRLIYQRVMIEIMDKDCVRYVDRDVILPLAIGCCFVYPDGVE
FT                   ESAALWGSQESLGVK"
FT   CDS             180. .2636
FT                   /db_xref="GOA:Q96606"
FT                   /db_xref="InterPro:IPR002166"
FT                   /db_xref="InterPro:IPR007094"
FT                   /db_xref="InterPro:IPR007095"
FT                   /db_xref="UniProt/TrEMBL:Q96606"
FT                   /note="readthrough stopcodon of p33"
FT                   /transl_except=(pos:1068. .1070,aa:OTHER)
FT                   /product="protein of 92 kDa"
FT                   /protein_id="CAA44356.1"
FT                   /translation="METIKSWICPKKEIFVGDFAIGVNRKVPVDIFQLVCRVVLRYMRT
FT                   GKIECDSDSMTKFLVELLKTDCAAKWEWFMKRRQRGDYVIPLSIAALPIVPLLSYATRA
FT                   RAVSVKAFGNELSLNVRVPRPSVPKKGLLLRLAAGLALAPICALAMYATLPREKLSVFK
FT                   LRTEARAHMEDEREATDCLVVEPARELKGKDGEDLLTGSRMTKVVASTGRPRRRPYAAK
FT                   IAQVARAKVGYLKNSPENRLIYQRVMIEIMDKDCVRYVDRDVILPLAIGCCFVYPDGVE
FT                   ESAALWGSQESLGVKXGGLVRLPGVVTQINRDIPSGVLLPQEVLEVRAGPPNAKDRNIY
FT                   MVAGCPSQARFLVHNHCLKNLKRGLVERVFCVERNGRLTRTPQPTKGSFGRLSPFRKAV
FT                   CEKVGVAHRLGYDGFLSYYSGAKLRTYTRAVESLHITPVSERDSHLTTFVKAEKISTSK
FT                   GDPAPRVIQPRNPRYNVELGRYLRHMESKLMKAVDGVFGETTCIKGYTADEVGAIFREK
FT                   WDRFDKPVAIGLDASRFDQHCSVEALQYEHSFYRAMYPGNKLLSKLLEWQLHNKGKGYV
FT                   PDGTITYRKEGCRMSGDINTSLGNYLLMCAMIHGYMRHLGINEFSLANCGDDCVLIVER
FT                   RNLKQIQRTLPEYFLNLGFTMKVEPPVFQLEEVEFCQAHPVQFQGGWKMVRNVRTAMSK
FT                   DVHCVNNIRDLATRRAWSNAQHHGGLALSAGIPVVEKFYSRFTLYDVPRKHQRIDTVTN
FT                   VHKWRGSGGSHTVTPESRASFWAAFGLTGDEQLALEDRLDRWEMDLFGEEGVDAHEPSI
FT                   LDSAVA"
FT   CDS             2667. .3833
FT                   /db_xref="GOA:P14836"
FT                   /db_xref="HSSP:2TBV"
FT                   /db_xref="UniProt/Swiss-Prot:P14836"
FT                   /evidence=EXPERIMENTAL
FT                   /product="coat protein of 41 kDa"
FT                   /protein_id="CAA44357.1"
FT                   /translation="MAMVKRNNNTGLIPVSTKQLMALGAAAGASALQGFVRNNGAAIVG
FT                   KVVDVGQKVYKAVKKRGGKKQQQIKHVGGTGGAIMAPVAVTRQLTGSKPKFTGKTSGSV
FT                   TVTHREYLSQVNMSTGFQVNGGIVGNLLQLNPLNGTLFSWLPAIASNFDQYSFNSVLLH
FT                   YVPLCATTEVGRVAMYFDKDSEDPEPADRVELANYSVLAETAPWAERALWVPTDRIKRF
FT                   CDDSSTLDHKLIDLGQLGVATYGGAGTNAVGDIFISYSVTLYFPQPTNTLLSTRRLDLA
FT                   GTPVTASGPGYILLTRTPTVLTMTFRATGTFVISGAYRCLTSTVLGLTGGVNVNSITVV
FT                   DNVGTSSSFFINCTVSNLPSVITFTTTGITSATIQCNRATRQNDVSLI"
FT   CDS             3871. .4440
FT                   /db_xref="GOA:Q65015"
FT                   /db_xref="InterPro:IPR005332"
FT                   /db_xref="UniProt/TrEMBL:Q65015"
FT                   /product="protein of 22 kDa"
FT                   /protein_id="CAA44358.1"
FT                   /translation="MDTEYEQVNKPWSELYKETTLGNKLMVNVGMEDQEVPLLPSNFLT
FT                   KVRVGLSGGYITMRRIRIKIIPLVSRKAGVSGKLYLRDISDTTGRKLHCTESLDLGREI
FT                   RLTMQHLDFSVSTRSDVPIVFGFEELVSPFLEGRELFSISVRWQFGLSKNCYSLPQSKW
FT                   KVMYQEDALKVLKPSKKKASRTDSSV"
FT   CDS             3903. .4421
FT                   /db_xref="GOA:Q65016"
FT                   /db_xref="HSSP:1R9F"
FT                   /db_xref="InterPro:IPR004905"
FT                   /db_xref="UniProt/TrEMBL:Q65016"
FT                   /product="protein of 19 kDA"
FT                   /protein_id="CAA44359.1"
FT                   /translation="MERVIQGNDAREQANGERWDGGSGGTTSPFKLPDESPSWTEWRIH
FT                   NDETDSNKDNPLGFKESWGFGKVVFKRYLRYDRTETSLHRVLGSWTGDSVNYAASRFLG
FT                   VNQIGCTYSIRFRGVSVTISGGSRTLQHLCEMAIRSKQELLQLAPVEVESNVSRGRPEG
FT                   AEAFKEESE"
FT   misc_RNA        2635. .4789
FT                   /evidence=EXPERIMENTAL
FT                   /note="subgenomic RNA 1"
FT   misc_RNA        3856. .4789
FT                   /evidence=EXPERIMENTAL
FT                   /note="subgenomic RNA 2"
XX
SQ   Sequence 4789 BP; 1234 A; 981 C; 1326 G; 1247 T; 1 other;

   X62493  Length: 4789  May 10, 2005 10:10  Type: N  Check: 1088  ..

       1  naaattctcc aggatttctc gacctcggtt gttttatctg gtagtttgcg
      51  ctaatcttcg ctttgcgtag ggaatttctc tccttaatac atttctgagt
     101  taaggggttt gaaggttggg tctatctttt gagtttatct cactagagga
     151  taaattgtaa cttccaacaa ataagcgata tggagaccat caagagctgg
     201  atttgtccta agaaagagat ttttgtaggg gattttgcga tcggagtgaa
     251  taggaaggtt ccggtggaca tctttcagtt ggtgtgtcgt gtggttctga
     301  gatacatgag gacagggaaa atagagtgcg attctgacag catgactaag
     351  tttttggtag agttacttaa aaccgattgt gctgctaaat gggagtggtt
     401  catgaagaga cggcagagag gtgattatgt catccctcta tctatagctg
     451  ctctcccaat cgtgccgctg ttgagttatg ccactagggc acgcgcagtc
     501  tcagtcaagg cattcggcaa tgagctatcg ctcaatgttc gcgtgcctag
     551  accttctgtg cctaagaaag gcctactcct cagactggcg gcaggtctag
     601  cgttagctcc tatatgcgcg ctggccatgt acgctaccct acccagggaa
     651  aaactgtctg tattcaagct gagaactgag gcacgtgcac atatggaaga
     701  tgagagagaa gcaacggatt gcttggtggt tgagcccgct cgtgagctca
     751  aagggaagga tggtgaggat ctactcactg gtagtaggat gacgaaggtg
     801  gtagcatcca caggacgtcc tcggaggaga ccgtatgccg caaaaattgc
     851  gcaggtcgcg agggccaaag tgggctatct taagaatagc cccgagaata
     901  ggcttatcta ccagagagtg atgatcgaga taatggacaa ggactgcgtc
     951  aggtatgttg acagggatgt catattgcca ttggctattg gatgctgttt
    1001  tgtctatccg gacggagttg aggagtcggc tgcactatgg ggttcccagg
    1051  aatcccttgg tgtgaaatag ggaggcctag tacgtctacc tggggttgta
    1101  acacagatca atcgagatat cccatctggt gtgttgcttc cccaggaggt
    1151  gctagaggtt cgtgcaggac ctcccaatgc taaggaccgt aatatatata
    1201  tggttgcagg ttgcccatca caggcacggt tcttagtgca taatcactgc
    1251  ctgaaaaacc ttaaaagggg tcttgtggag agagttttct gcgttgagag
    1301  aaacgggaga cttactcgca ctccacaacc taccaaagga tcctttggac
    1351  gtctttcccc gttcaggaaa gcggtttgtg agaaggttgg agttgcccac
    1401  cggttggggt atgacggttt cctgtcatac tacagcggcg cgaagctccg
    1451  tacttacaca cgagctgtgg agagtctgca tattactcct gtctctgaga
    1501  gagatagtca tttgactacc tttgtcaagg ctgagaaaat atcgacgtct
    1551  aagggtgacc cagctcctag ggtgattcag cctcgaaacc ctaggtacaa
    1601  tgtggaactt ggaagatatc tacggcatat ggaatccaag ctgatgaaag
    1651  ctgtcgatgg cgttttcggt gagacaacgt gcatcaaagg atatactgca
    1701  gatgaggtgg gtgcaatttt tcgggagaag tgggataggt ttgataaacc
    1751  cgtcgccatt ggtcttgatg cgtccaggtt tgatcaacac tgttccgttg
    1801  aggctttgca atatgagcat agcttctaca gggccatgta ccctggcaac
    1851  aagcttttga gcaagttgtt ggaatggcaa ctccataata aaggtaaggg
    1901  ttatgtccct gatgggacta taacttatcg taaggagggg tgccgtatga
    1951  gtggggatat caatacttca ttgggcaact atctgttgat gtgcgctatg
    2001  atacacgggt acatgcgcca tttgggaatt aatgaattta gtctggcaaa
    2051  ctgcggggat gactgcgttc taattgtgga gcggaggaat cttaagcaga
    2101  tacagaggac cctacctgag tatttcctaa atttagggtt tacaatgaag
    2151  gtggagccac ctgtgtttca attggaagag gttgaattct gccaggcaca
    2201  cccagtacag tttcaaggtg gttggaagat ggtccgcaat gtccgcactg
    2251  ctatgagcaa agatgtacat tgtgtcaata atatacgtga cttggccacg
    2301  aggagggcct ggagtaatgc tcaacaccat ggtgggctgg cattgagtgc
    2351  cggaatacct gtggttgaga aattttactc taggttcacg ttgtatgacg
    2401  tgcctcgtaa acatcaacgg attgacactg taaccaatgt tcataagtgg
    2451  cgtggatctg gtggtagcca tactgtgacc cctgagtcaa gggctagctt
    2501  ttgggctgcc ttcggtttga cgggggatga gcagttggct ttggaggatc
    2551  gtctggatag atgggagatg gatttgtttg gagaggaggg tgttgacgct
    2601  catgagccca gcatccttga ctccgccgta gcttgaccaa gaacacataa
    2651  aacacaggac tagcacatgg caatggtaaa gagaaataat aacactgggc
    2701  ttatcccagt tagcacgaag cagttaatgg cattaggagc ggccgcaggg
    2751  gcttcagccc tgcagggatt tgtaaggaac aacggggcgg ctattgtcgg
    2801  aaaggtcgtc gatgttggac agaaggtgta caaagcagtg aagaagcgag
    2851  gaggtaagaa acagcagcag attaagcatg taggtggtac aggtggggcc
    2901  attatggccc cggttgcagt tacgagacaa cttaccggga gtaagcctaa
    2951  gtttaccggt aagacgtctg ggtctgtgac ggttacgcac cgtgaatact
    3001  tatcacaagt gaatatgtcc acaggtttcc aggtaaacgg gggaattgtt
    3051  ggcaatttgt tacagctcaa cccgttgaat ggtactttgt tctcatggtt
    3101  gcccgcgata gcgtccaact ttgatcagta ctcgttcaac agcgttttgc
    3151  tacattatgt ccctctgtgc gcaaccactg aggtggggcg agtggctatg
    3201  tactttgata aagattcgga agatcctgaa cctgctgata gggttgagtt
    3251  ggcaaactac agcgtactag cagagacagc cccctgggct gaacgtgcgc
    3301  tctgggttcc taccgatagg attaagagat tttgtgatga cagttccaca
    3351  ttagatcaca aacttatcga tctaggacag ttgggcgtgg ctacatatgg
    3401  tggcgctgga actaatgctg ttggggatat cttcatctcc tacagtgtta
    3451  cgttatattt ccctcaacct acgaatactc tccttagcac tagaaggctc
    3501  gaccttgctg gcacaccggt cacagcatcc ggacccgggt acatcctgtt
    3551  aaccaggacg cccactgtac ttacaatgac atttcgtgcc actggcacgt
    3601  ttgtcatctc tggagcatat cgttgtctaa cttcaacggt gctcggcctg
    3651  acaggtgggg tcaacgtgaa cagcattaca gttgtggaca atgttggaac
    3701  gagcagttca tttttcataa attgcactgt ctcaaaccta ccgtccgtta
    3751  tcacgtttac taccactggt ataacatctg ctacgataca gtgcaatcgt
    3801  gctacgcgac agaacgatgt ctctttaatt tagtgagtcc tgtgaggggc
    3851  ctcttgaact agaccagttc atggatactg aatacgaaca agtcaataaa
    3901  ccatggagcg agttatacaa ggaaacgacg ctagggaaca agctaatggt
    3951  gaacgttggg atggaggatc aggaggtacc acttctccct tcaaacttcc
    4001  tgacgaaagt ccgagttgga ctgagtggag gatacataac gatgagacgg
    4051  attcgaataa agataatccc cttggtttca aggaaagctg gggtttcggg
    4101  aaagttgtat ttaagagata tctcagatac gacaggacgg aaacttcatt
    4151  gcacagagtc cttggatctt ggacgggaga ttcggttaac tatgcagcat
    4201  ctcgatttct cggtgtcaac cagatcggat gtacctatag tattcggttt
    4251  cgaggagtta gtgtcaccat ttctggaggg tcgagaactc ttcagcatct
    4301  ctgtgagatg gcaattcggt ctaagcaaga actgctacag cttgccccag
    4351  tcgaagtgga aagtaatgta tcaagaggac gccctgaagg tgctgaagcc
    4401  ttcaaagaag aaagcgagta ggacagactc ttcagtctga ttctgtggaa
    4451  atgagagtaa ttctgacata gcatacaggt tactcgtgtt gggttctaga
    4501  tgttatgatg acgagctggt cgggctccgc acgggtttgg tcgcccgggg
    4551  atggagatat ggaaagggtc tcgtgtgctg ttagtcagtc gaaagacgtg
    4601  cttgcaacat gggcctataa ccagataagt catagcaata ctagccaaca
    4651  tgaattggat tcctgtttac gaaagttagg tgtcacttgt ggagacagag
    4701  ttagacacgg ttgatctcac ccttcggggg ggctatagag atcactggaa
    4751  gcactaccgg acaaccggaa cattgcagca atgcagccc