Sequence of DPV Beet yellows virus

Beet yellows virus (isolate German BYV-G) genes for putative membrane-binding protein, heat shock 70-related protein, coat protein homolog and coat protein

ACC No: X73475

Dated: 1993-10-01 | Length: 5980 | CRC: 1537243603

                !!NA_SEQUENCE 1.0
ID   BYVMBPA    standard; RNA; VRL; 5980 BP.
XX
AC   X73475;
XX
SV   X73475.1
XX
DT   08-JUL-1993 (Rel. 36, Created)
DT   01-OCT-1993 (Rel. 37, Last updated, Version 7)
XX
DE   Beet yellows virus (isolate German BYV-G) genes for putative
DE   membrane-binding protein, heat shock 70-related protein, coat protein
DE   homolog and coat protein
XX
KW   coat protein; heat shock 70-related protein; membrane-binding protein.
XX
OS   Beet yellows virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RA   Agranovsky A.A., Koonin E.Y., Boyko V.P., Maiss E., Lunina N.A.,
RA   Atabekov J.G.;
RT   "Beet yellows closterovirus: complete genome structure and identification
RT   of a leader papain-like thiol protease";
RL   Unpublished.
XX
RN   [2]
RP   1-5980
RA   Maiss E.;
RT   ;
RL   Submitted (18-JUN-1993) to the EMBL/GenBank/DDBJ databases.
RL   E. Maiss, Inst. f. Biochemie und Pflanzenvirologie, Biologische
RL   Bundesanstaldt, Institut fuer Biochemie, Messeweg 11/12 D-3300
RL   Braunschweig, FRG
XX
DR   SPTREMBL; Q03724; Q03724.
DR   SPTREMBL; Q65893; Q65893.
DR   SPTREMBL; Q65894; Q65894.
DR   SPTREMBL; Q65895; Q65895.
DR   SPTREMBL; Q65896; Q65896.
DR   SPTREMBL; Q65897; Q65897.
DR   SPTREMBL; Q65898; Q65898.
XX
FH   Key             Location/Qualifiers
FH
FT   CDS             71. .235
FT                   /db_xref="SPTREMBL:Q65893"
FT                   /note="putative membrane-binding protein"
FT                   /protein_id="CAA51857.1"
FT                   /translation="MDCVLRSYLLLAFGFLICLFLFCLVVFIWFVYKQILFRNNPPSNE
FT                   ARFNRSTVV"
FT   CDS             235. .2031
FT                   /db_xref="SPTREMBL:Q65894"
FT                   /product="heat shock 70-related protein"
FT                   /protein_id="CAA51858.1"
FT                   /translation="MVVFGLDFGTTFSSVCAYVGEELYLFKQRDSAYIPTFVFLHSDTQ
FT                   EVAFGYDAEVLSNDSSVRGGFYRDLKRWIGCDEENYGDYLEKLKPHYKTELLKVAQSSK
FT                   STVKLDCYSGTVPQNATLPGLIATFVKALISTASEAFKCQCTGVICSVPANYNCLQRSF
FT                   TESCVNLSGYPCVYMVNEPSAAALSACSRIKGATSPVLVYDFGGGTFDVSVISALNNTF
FT                   VVRASGGDMNLGGRDIDKAFVEHLYKKAQLPVNYKIDISFLKESLSKKVSFLNFPVVSE
FT                   QNVKVDVLVNVSELAEVAAPFVERTIKIVNEVYEKYRGSMRLEPSVKAKLLMVGGSSYL
FT                   PGLLSRLSSVPFVEECLVLPDARAAVAGGCALYSACLRNDSPMLLVDCAAHNLSISSKY
FT                   CESIVCVPAGSPIPFTGVRTVNMTGSNASAVYSAALFEGDFVKCRLNKRIFSGDVALGD
FT                   VGVFGSNTRTVPLTLEINVSSVGTITFSLVGPTGVKKLVGGNAAYDFSSYQLGERVVAD
FT                   LHKHNSDKVKLIHALTYKPFQRKKLTDSDKALFLKRLSADYRREARKFSSYDDAVLNSS
FT                   ELLLGRVIPKILRGSRVEKLDV"
FT   CDS             1937. .3598
FT                   /db_xref="SPTREMBL:Q65895"
FT                   /note="orf4"
FT                   /protein_id="CAA51859.1"
FT                   /translation="MTTRFSTPANYYWGELFRRFFGGREWKNLMSEAASVRRPVYARDF
FT                   RFSNGEVLSRKIFSDSTGESFVREFSLLLTFPKTYEVCKLCGVAMEQALSGMNRLSDYN
FT                   VSELNVVDVKTVGCKFNIQTVTEFVKKLNGNLAEPSLVEHCWSLSNSCGELINPKDTKR
FT                   FVSLIFKGKDVIESTDEAIVSSSYLDYLSHCLNLYETCNLSSNSGKKALYDEFLKYVIA
FT                   YLETSDLEYHSPSDNPLVAGVLYDMCFEYNTLKSTYLKNIESFDCFLSLYLPLLSEIFS
FT                   MNWEQPAPDVRLLFELDTAELLLKIPTINTLDSTFLYKNKLRYLESYFEDDSNELIKVK
FT                   VDSLLTRDNPELKLAQRWVGFHCYYGVFRTAQTRKVKRDAEYKPCPALGEFTINMSGVE
FT                   EFFDELQKKMPSVSVRRRFCGSLSHEAFSIFKRFGVGFPPITRLNVPVKYSYLNVDYYR
FT                   HVKRAGLTQDELTILSNIEFDVAEMCCEREVALQARRAQRREKPFQGWKGVKNEVSPHA
FT                   RSSIRVKKSNESLLNILWKDVGVRRQGRLNPLHRKH"
FT   CDS             3546. .4196
FT                   /db_xref="SPTREMBL:Q65896"
FT                   /product="coat protein homolog"
FT                   /protein_id="CAA51860.1"
FT                   /translation="MLASEGRGDLIHFTENTRDAMETFFNSYDLAEYSEVNPNKLNRKE
FT                   TDELLGVIRERFKSELVITDEDFVKHLAFALIRAANITTSTKVNYVGAYEYTIGGKKFL
FT                   VKDAWVFPLIKECMKKFNKPNPVRTFCATFEDAYIVIARSLPKLFLNRTIGKRGIPSGY
FT                   EFLGADFLTATSVCLNDHEKAIVLQASRAAIDRAVSSSVDGKIVSLFDLGRLS"
FT   CDS             4267. .4881
FT                   /db_xref="SPTREMBL:Q03724"
FT                   /product="coat protein"
FT                   /protein_id="CAA51861.1"
FT                   /translation="MGSAEPISAIATFENVSLADQTCLHGEDCDKLRKNFEECLKLKGV
FT                   PEDKLGLALGLCLYSCATIGTSNKVSVQPTSTFIKASFGGGKELFLTHGELRSFLDSQK
FT                   LLEGKPNKLRCFCRTFQKDYISFAKEYRGRLPPIARANRHGLPAEDHYLAADFISTSTE
FT                   LTDLQQGRLLLARENATHTEFSSESPVTSLKQLGRGLATGR"
FT   CDS             4878. .5411
FT                   /db_xref="SPTREMBL:Q65897"
FT                   /note="orf7"
FT                   /protein_id="CAA51862.1"
FT                   /translation="MIGSVELAQTRPFFRVLLLKGFVFYIVAIETEEEPSEAELPLVYL
FT                   HDLELNVNKKGKIESSYIDFKSCMNRLKPSSVSYTRVSSGKPSEDFSSSYSGKTFESRI
FT                   LNRKVTFTFENGTQLVFGMYGRDRRCVSSEYLWFENVFVGAHCGTLPYCLNCELDKSGG
FT                   DLEILTFSKNEVFL"
FT   CDS             5395. .5928
FT                   /db_xref="SPTREMBL:Q65898"
FT                   /note="orf8"
FT                   /protein_id="CAA51863.1"
FT                   /translation="MKFFFNDGETSRAISRSESLLRRVKELGTNSPQSEVSECINEFNE
FT                   LARFNHLLVTVEHREWMEKHPKQSSELRAPSRLGEMLKEIRAFLKVRVVTPMHKETASE
FT                   TLNAFLDEYCRIAGLTREDALREKMRKVRSTVLFHHSELLKFEVTENMFSFTELLKLNL
FT                   SLRVISSQILGIAV"
FT   source          1. .5980
FT                   /db_xref="taxon:12161"
FT                   /organism="Beet yellows virus"
FT                   /isolate="German (BYV0G)"
FT                   /clone="pBYV-D22, pBYV-D31"
XX
SQ   Sequence 5980 BP; 1557 A; 1267 C; 1431 G; 1725 T; 0 other;

X73475  Length: 5980  December 21, 2001 16:02  Type: N  Check: 1883  ..

       1  gcttgagact gtgtggtaac tcggttgttg tttttgtttg tttgtgtgtc
      51  tatagtccta cttcgcggtg atggactgtg tactccgctc gtatttatta
     101  ctcgcattcg ggtttttaat ttgcttgttt cttttctgct tagtggtttt
     151  tatttggttc gtgtataaac aaatactttt tcgaaacaac ccgccttcga
     201  acgaagcgcg tttcaaccgt tctacggtcg tgtgatggtt gttttcggat
     251  tagatttcgg cactactttt tcgagcgttt gcgcttacgt tggagaagaa
     301  ctctatttgt tcaaacaaag agacagtgct tacataccca cttttgtgtt
     351  tttacattcc gatactcaag aagtggcttt cggttacgat gccgaagttc
     401  tttctaacga ctcttcggtt cgtggaggtt tctatcgtga tttaaaacgc
     451  tggataggat gtgacgaaga gaattacggg gattacctgg aaaaactcaa
     501  gccgcactac aagacggaat tgcttaaagt tgcgcaaagt tcgaaatcca
     551  ccgtgaagtt agactgttac tcaggtaccg tgccgcagaa tgccactcta
     601  ccgggtttga tagcgacttt cgtcaaagct ctgatttcta cagccagtga
     651  agctttcaag tgtcagtgca ccggcgttat ttgttcggtc cctgccaact
     701  ataactgtct gcaaaggtct tttaccgaaa gttgtgtcaa cctaagcggc
     751  tacccctgtg tttacatggt taacgaaccg tcggctgcgg cgctttcagc
     801  ttgttccaga atcaaaggtg ctacttcgcc cgttctcgta tatgatttcg
     851  ggggtggaac gtttgatgtt tccgtgattt cagcgctcaa caacactttt
     901  gtggtgcgcg cttccggggg cgacatgaat ttgggaggcc gtgacatcga
     951  taaggctttt gttgagcact tgtacaaaaa ggctcaactg cccgtgaact
    1001  acaaaatcga tatttccttc ttgaaagaat cgctctcaaa gaaggtttcc
    1051  tttttgaact tcccggtggt cagtgaacag aacgtaaaag ttgacgtttt
    1101  ggttaatgtc agcgaactgg ctgaagtggc ggctcctttc gtagaaagaa
    1151  cgatcaagat cgttaatgaa gtttacgaaa aatatcgtgg tagcatgcga
    1201  ttagaaccga gtgttaaagc taaactgctc atggtaggtg gttcttccta
    1251  cttgccgggt cttttatcgc gtctttcctc cgtgcctttc gtggaagaat
    1301  gccttgtgct gcccgatgct cgagcggcag ttgctggggg gtgtgctttg
    1351  tactcagctt gtcttcgaaa tgattctccg atgttgctgg tcgactgtgc
    1401  ggctcacaat cttagcatta gtagtaaata ttgcgaatcc atcgtttgcg
    1451  ttccggctgg ttcacccatc ccgtttacgg gagttcgaac agttaacatg
    1501  actggttcca acgcttccgc tgtttacagt gcggcgcttt tcgaaggaga
    1551  cttcgtcaaa tgtcgcttaa acaaaaggat tttctctggt gacgtcgcct
    1601  taggagacgt cggggtgttt ggttcaaaca ctaggacggt cccgttaaca
    1651  ctcgaaatta atgtttcgag cgtcggaaca atcacttttt ccctcgtcgg
    1701  accgacaggt gttaagaagt tggtgggtgg aaatgctgct tacgatttct
    1751  cgagttatca gctcggggag cgcgtcgtcg cagacttgca caaacataat
    1801  tctgataaag tgaaacttat tcatgcgttg acgtataagc cttttcaaag
    1851  gaagaaattg actgacagcg acaaagctct gttcttaaag agactaagtg
    1901  cagactaccg acgtgaagcg agaaagttca gttcatatga cgacgcggtt
    1951  ctcaactcca gcgaactact actggggaga gttattccga agattcttcg
    2001  ggggtcgaga gtggaaaaac ttgatgtctg aagctgcttc ggttaggcgg
    2051  cctgtgtatg ctcgcgactt tcgtttttcg aacggtgaag tattaagtcg
    2101  caagattttc agcgactcaa ccggcgaatc atttgtacgc gagttttcat
    2151  tgctgctgac tttcccaaag acttatgaag tttgcaagtt atgcggtgtg
    2201  gctatggaac aagctctgag cggcatgaat cgtctatccg attataacgt
    2251  ctccgaactt aacgtcgtcg acgtgaaaac cgtgggttgc aagtttaata
    2301  tacaaaccgt cacagaattc gtgaaaaagc tcaacgggaa tctggccgaa
    2351  ccttctctcg tcgagcactg ttggtctctg tctaattctt gcggcgaact
    2401  gatcaatccg aaagacacga agcggttcgt ttctctcatc tttaagggga
    2451  aagacgtcat cgaaagcacc gatgaagcca tagtttcctc ttcttactta
    2501  gattaccttt cacactgttt gaacttgtat gaaacgtgta acctttcgtc
    2551  taactcgggg aagaaagctc tgtacgatga atttctaaag tacgtgatcg
    2601  cttatcttga gactagtgac ttagagtacc attcaccttc cgataaccct
    2651  ttggttgctg gtgttcttta cgatatgtgt tttgaatata acacgctcaa
    2701  gtcgacgtac ctaaagaaca tagagtcgtt cgactgtttt ttgagtctgt
    2751  acttaccgtt gctcagtgaa atcttttcga tgaattggga acaaccagcg
    2801  cctgacgtcc ggttgctttt cgaactcgat acagccgaac ttcttttgaa
    2851  aattccgact atcaacacgc tcgactcaac ttttttgtat aagaacaagt
    2901  tgaggtacct ggaatcctac tttgaagacg actctaatga gctcataaag
    2951  gtgaaagttg attcactctt aacccgagac aatcctgaac tgaaactagc
    3001  tcagaggtgg gtaggtttcc attgttacta cggggttttt aggaccgctc
    3051  agactaggaa agtgaaaaga gatgcggaat acaaaccctg tccggctctc
    3101  ggtgaattca caataaacat gagtggagtg gaagaattct ttgatgagct
    3151  gcagaagaaa atgccttctg tttctgttcg tcgcagattt tgtggcagtt
    3201  tgtctcacga agctttttcc attttcaaga gattcggggt gggtttccct
    3251  ccgatcacca gattaaacgt tcccgtgaag tactcctatc taaacgttga
    3301  ttattacaga cacgtgaaga gagcgggctt gacgcaggac gagttgacta
    3351  ttctcagtaa catcgaattc gacgtcgctg aaatgtgctg cgagagggaa
    3401  gtggctttac aagcccgtcg cgctcagcgg cgcgaaaaac catttcaggg
    3451  ttggaaaggt gtcaaaaacg aagtttctcc gcacgcgcgt tcctcaattc
    3501  gagtgaaaaa gagcaacgaa tcgttactaa acattttgtg gaaagatgtt
    3551  ggcgtccgaa ggcaggggag acttaatcca cttcaccgaa aacactagag
    3601  atgccatgga aactttcttc aacagctacg atttagctga atactccgaa
    3651  gtgaacccta acaaactcaa tcggaaagag accgacgagt tgttaggtgt
    3701  tattcgagag agatttaaat ccgaattggt gataacagat gaagattttg
    3751  tgaaacattt agccttcgcg ttgattcgcg cggccaatat caccactagt
    3801  acgaaagtca actacgtcgg agcgtacgag tatacgatag ggggaaagaa
    3851  gttcctggtt aaggacgctt gggttttccc tttaataaag gagtgtatga
    3901  aaaagttcaa caaacccaat cctgtgagga cgttttgtgc cactttcgaa
    3951  gacgcttaca tagtgatagc tcgttcgttg cccaaactgt tcctgaatag
    4001  aaccattggc aaacgtggga tcccgtcagg gtatgaattc ctcggggcgg
    4051  attttctaac tgcgaccagc gtgtgtttga acgatcacga aaaagctatc
    4101  gtactacagg cttcaagagc tgccattgat agagcagtct cttcgtcggt
    4151  cgacgggaag atcgtcagtc ttttcgacct cggtcgtctt agttaacaca
    4201  gttactaagg ttccatttta ttattgtatt gtttttcatt tagtgtaatc
    4251  gtacttgagt tctgacatgg gatcagccga acctataagt gcaatcgcga
    4301  cttttgaaaa cgtgagtctc gcagaccaaa cgtgtttgca cggtgaagac
    4351  tgcgacaaac tacggaagaa tttcgaagag tgtttaaaat tgaaaggggt
    4401  tccggaagac aaactcggtc tcgcgttagg actttgtttg tattcctgtg
    4451  cgacgatagg tacttctaat aaagttagtg tccaaccgac gtctactttc
    4501  atcaaagctt cgttcggtgg tgggaaggaa ttgttcctca ctcacggtga
    4551  actgaggtct tttctggact ctcagaaact tttggaagga aagcctaaca
    4601  agttgcgttg tttctgccgc acttttcaga aggactacat atccttcgcg
    4651  aaggaatacc gaggaagact gcctccgatt gctagagcca accgtcacgg
    4701  tctacctgct gaagatcact acttagctgc tgatttcata tcgacatcaa
    4751  cagaacttac tgacctacaa caaggtcgtc tgctgttggc gcgcgaaaac
    4801  gccactcaca cagagttctc gtctgaatca ccagtaacta gtttgaaaca
    4851  gctgggtcgt ggtctagcca ccggaagatg attggctctg tcgaactagc
    4901  tcagacgaga ccctttttta gagtattact gttaaagggt ttcgtttttt
    4951  atattgttgc aatcgaaaca gaagaagaac catctgaagc tgaacttcct
    5001  ttggtttacc tccacgatct cgagttgaat gttaacaaaa agggaaaaat
    5051  cgaatcttcg tacatcgact ttaaatcttg tatgaatagg ttgaaaccca
    5101  gttcggtctc ttacactcga gtgagttctg gaaaaccttc agaagatttc
    5151  tcttcatcgt actcaggaaa aactttcgaa tcaagaattc ttaaccgtaa
    5201  agtgacgttt acattcgaaa atggcactca actcgtgttc gggatgtacg
    5251  gtcgcgatcg gcggtgtgtg tcttctgagt acttgtggtt tgaaaacgta
    5301  ttcgtcggtg cgcactgcgg caccttaccc tattgtctga attgcgaatt
    5351  agacaaaagc ggtggtgatt tggaaatttt gactttttca aaaaatgaag
    5401  tttttcttta atgatggtga aacttctcga gccatatcta ggtctgaatc
    5451  gctcctacgt cgtgtgaagg aacttggaac gaattcgccg caaagcgaag
    5501  tctctgagtg catcaacgaa ttcaacgaac tagcaagatt taatcacttg
    5551  ttagttacgg tcgaacacag ggaatggatg gaaaaacatc cgaaacagtc
    5601  gtcggaactt cgagccccgt cacgacttgg cgaaatgctc aaagaaattc
    5651  gtgcgttcct taaggtgcgc gtggtaactc ctatgcataa ggagactgcc
    5701  agcgaaactc tgaacgcgtt tctggacgag tactgccgaa ttgctggact
    5751  cactcgcgag gatgccttgc gagaaaaaat gaggaaagta aggagtacgg
    5801  tgctgtttca tcactcggaa cttttgaagt tcgaagtgac tgaaaacatg
    5851  ttcagtttta ctgaactact aaaactaaat ctaagcttga gggtgatttc
    5901  ttctcaaatc ctcggaatag ctgtatagag aagtaacgga ggcgacctac
    5951  ctgccgtgta atttaagtcg tcacagagtg