Sequence of DPV Oat chlorotic stunt virus

Oat chlorotic stunt virus RNA for RNA-dependent RNA polymerase (putative) and coat protein

ACC No: X83964

Dated: 2005-04-18 | Length: 4114 | CRC: -895348958

                !!NA_SEQUENCE 1.0
ID   OCSVIR     standard; genomic RNA; VRL; 4114 BP.
XX
AC   X83964;
XX
SV   X83964.1
XX
DT   24-OCT-1995 (Rel. 45, Created)
DT   18-APR-2005 (Rel. 83, Last updated, Version 4)
XX
DE   Oat chlorotic stunt virus RNA for RNA-dependent RNA polymerase (putative)
DE   and coat protein
XX
KW   coat protein; RNA-dependent RNA polymerase.
XX
OS   Oat chlorotic stunt virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Avenavirus.
XX
RN   [1]
RX   MEDLINE; 95363422.
RX   PUBMED; 7636483.
RA   Boonham N., Henry C.M., Wood K.R.;
RT   "The nucleotide sequence and proposed genome organisation of oat chlorotic
RT   stunt, a new soil-borne virus of cereals.";
RL   J. Gen. Virol. 76:2025-2034(1995).
XX
RN   [2]
RP   1-4114
RA   Boonham N.;
RT   ;
RL   Submitted (17-JAN-1995) to the EMBL/GenBank/DDBJ databases.
RL   N. Boonham, The University of Birmingham, The School of Biological
RL   Sciences, Edgbaston, Birmingham, B15 2TT, UK
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .4114
FT                   /db_xref="taxon:146762"
FT                   /mol_type="genomic RNA"
FT                   /organism="Oat chlorotic stunt virus"
FT   CDS             48. .686
FT                   /db_xref="UniProt/TrEMBL:Q83926"
FT                   /gene="orf p23"
FT                   /protein_id="CAA58796.1"
FT                   /translation="MSWPSLSGVPNGSSSVSTWLSVTHPRRSLPKELLTAFDTCNVAPE
FT                   ALLVLRSTSLMILEETCVVVGAAEMPTAEDNSGRELFIGSNGDPMERKTRTAHHAIKKT
FT                   VRIKKGHRTTFAMTVANGAYVKFGARPLTEANVLVVRKWIVKLIADEYKDLRVCDQALV
FT                   IDRATFLSFIPTMAWNNYKFIFHGKNAVTDRVAGENLFSRIAQWANPGK"
FT   CDS             48. .2306
FT                   /db_xref="GOA:Q83927"
FT                   /db_xref="InterPro:IPR001589"
FT                   /db_xref="InterPro:IPR002166"
FT                   /db_xref="InterPro:IPR007094"
FT                   /db_xref="InterPro:IPR007095"
FT                   /db_xref="UniProt/TrEMBL:Q83927"
FT                   /note="amber"
FT                   /transl_except=(pos:684. .686,aa:OTHER)
FT                   /product="putative RNA-dependent RNA polymerase (p84)"
FT                   /protein_id="CAA58797.1"
FT                   /translation="MSWPSLSGVPNGSSSVSTWLSVTHPRRSLPKELLTAFDTCNVAPE
FT                   ALLVLRSTSLMILEETCVVVGAAEMPTAEDNSGRELFIGSNGDPMERKTRTAHHAIKKT
FT                   VRIKKGHRTTFAMTVANGAYVKFGARPLTEANVLVVRKWIVKLIADEYKDLRVCDQALV
FT                   IDRATFLSFIPTMAWNNYKFIFHGKNAVTDRVAGENLFSRIAQWANPGKXGCPVVVTGQ
FT                   GCVISRAPDCAQLRVKRLLGVTKNRTCMRVSGVSPNIQIIPFNNDITTLERAIKERVFF
FT                   VKNLDKGSPTKFVSPPRPAPGVFAQRLSNTLGLLVPFLPSTAPMSHQQFVDSTPSRKRK
FT                   VYQQALEDISCHGLNLETDSKVKVFVKYEKTDHTSKADPVPRVISPRDPKYNLALGRYL
FT                   RPMEERIFKALGKLFGHRTVMKGMDTDVTARVIQEKWNMFNKPVAIGLDASRFDQHVSL
FT                   EALEFEHSVYLKCVRRMVDKRKLGNILRHQLLNKCYGNTPDGAVSYTIEGTRMSGDMNT
FT                   SLGNCVLMCMMIHAYGLHKSVNIQLANNGDDCVVFLEQSDLATFSEGLFEWFLEMGFNM
FT                   AIEEPSYELEHIEFCQCRPVFDGVKYTMCRNPRTAIAKDSVYLKHVDQFVTYSSWLNAV
FT                   GTGGLALAGGLPIFDAFYTCYKRNSNSHWFSGRKGRLKTLSSVDDSLPWFMRELGLKGK
FT                   RSSAEPLPASRASFYLAWGVTPCEQLELEKYYKSFKLDTSTLLEEHLWQPRGVFPDED"
FT   CDS             2483. .3847
FT                   /db_xref="GOA:Q83928"
FT                   /db_xref="HSSP:2TBV"
FT                   /db_xref="InterPro:IPR000937"
FT                   /db_xref="UniProt/TrEMBL:Q83928"
FT                   /evidence=EXPERIMENTAL
FT                   /product="coat protein (p48)"
FT                   /protein_id="CAA58798.1"
FT                   /translation="MTLNLRKVPAYLPGKVDGALTNLVHAAVDHVVPGLGKAEKAAAVY
FT                   NIKQVVKKLGTYTEQGVKKIAKKTLGELGYLNYTPSSHLGMAITGRGTKQINMSRSTNA
FT                   GGFALGGTTAAPVSISRNINRRSKPSIKMMGDAVVISHSEMLGAINSGTPSSNVTAFRC
FT                   TGYRANPGMSTIFPWLSATAVNYEKYKFRRLSFTLVPLVSTNYSGRIGVGFDYDSSDLV
FT                   PGNRQEFYALSNHCENMPWQESTVEIKCDNAYRFTGTHVAADNKLIDLGQVVVMSDSVS
FT                   NGGTISAALPLFDLIVNYTVELIEPQQALFSSQLYSGSTTFTSGIPLGTGADTTTVVGP
FT                   TVVNSTTVTNCVVTFKLPAGVFEVSYFIAWSTGTAAVVPTVPTTGAGSKLSNTSTGSNS
FT                   YGVCFINSPVECDLLLTATVLLIIPTLPSSTCVFHAPARRCTTPMCHRLLTSLAG"
FT   CDS             2889. .3113
FT                   /db_xref="UniProt/TrEMBL:Q83929"
FT                   /gene="orf p8"
FT                   /protein_id="CAA58799.1"
FT                   /translation="MRWLSRTVKCWVPLILAPLHRMSPLSVALATELILGCQLSSLGCL
FT                   QLPLITRSTNFVGSASLLSRWFLPIIAEE"
XX
SQ   Sequence 4114 BP; 996 A; 1001 C; 1076 G; 1041 T; 0 other;

   X83964  Length: 4114  May 10, 2005 10:10  Type: N  Check: 8080  ..

       1  ttaaatcgtc ccgatttagc aagccatggc tctttatccg tctcaagatg
      51  tcttggccct cactcagtgg ggtgccaaat ggctcaagtt cggtttcaac
     101  atggttgtcg gtaacacacc cgaggcgcag tttgcccaag gaactcctca
     151  cggcgtttga tacatgtaat gtggctcccg aagcactttt ggtgttgcgg
     201  tccacatcgt tgatgatact tgaggaaacc tgtgtggttg tgggtgcggc
     251  agagatgccc accgctgagg ataactctgg tcgggagttg ttcattggct
     301  ccaacggtga cccgatggaa aggaaaaccc gcacggcgca ccatgccatc
     351  aagaagaccg tgcgcatcaa gaaagggcat cgcacaacct tcgccatgac
     401  tgtggcgaac ggggcgtatg tcaagtttgg tgcccgtcca ttgacggagg
     451  caaatgtgct ggtcgtgcgt aaatggatcg ttaagcttat tgctgacgag
     501  tacaaggatt tgcgggtgtg cgaccaggca ctggttatag accgtgccac
     551  gttcctatca ttcattccta ccatggcgtg gaataactat aagtttatct
     601  tccacggtaa gaatgccgtc acagatcgcg tggcgggaga gaacctgttt
     651  tcccggatcg cccaatgggc gaatccaggg aaataggggt gcccagtagt
     701  cgtcacaggg cagggatgcg tcattagccg cgctcccgat tgtgcccagt
     751  tgcgtgtgaa gaggctattg ggagtcacaa agaaccggac atgtatgcgt
     801  gtgtctgggg tttcccctaa catccaaatc atcccgttca ataacgacat
     851  cacgactctg gagagggcca taaaagagag ggtgttcttt gtcaaaaacc
     901  tcgacaaggg atcgcccacc aaatttgtct cccctcccag acctgcgcct
     951  ggtgtgtttg cccagagatt gtcaaatacg ttgggactgt tagtaccttt
    1001  tcttccctcg accgctccga tgtcacatca gcaatttgtt gatagcacgc
    1051  cgagccgcaa gaggaaggtg taccaacagg ctctcgagga tatcagttgt
    1101  catgggctga acctcgagac agacagcaag gtgaaggtgt ttgtgaaata
    1151  cgagaaaacc gaccatacat ccaaggcaga tccagtgccg cgggtgattt
    1201  ctccccgtga tcctaagtac aacctggcgc tcggcaggta tcttaggccc
    1251  atggaagaac gaatattcaa ggcgcttggc aaattattcg gccatcgcac
    1301  cgtcatgaaa ggtatggata ccgatgtgac ggctagggtg atccaggaga
    1351  aatggaacat gttcaacaag cctgtagcta taggcttgga tgcgtctaga
    1401  tttgaccagc atgtttcact ggaagcgctt gaatttgagc attcagtgta
    1451  cctcaagtgt gtgcgcagga tggtggacaa gcgtaagctt ggcaacatcc
    1501  tgcgacatca acttctaaac aaatgttacg gcaacacgcc tgatggcgcg
    1551  gtgtcgtaca ccattgaggg tacacgaatg agtggggaca tgaacacatc
    1601  cctaggtaat tgcgttttga tgtgtatgat gatccacgct tatggtttgc
    1651  ataagagtgt caacatacaa ctggcgaaca atggggatga ttgtgtcgtg
    1701  tttctggagc aatccgattt ggccaccttc tcagaaggct tgtttgaatg
    1751  gttcctagaa atgggattca acatggccat cgaggagccc tcctacgaac
    1801  tggagcatat cgagttttgt cagtgcaggc cggtgtttga tggtgttaaa
    1851  tacaccatgt gccggaaccc ccgcactgcc attgctaaag atagcgtgta
    1901  tctgaaacac gttgatcagt tcgtcacata ttctagctgg ctgaatgccg
    1951  tggggacagg tgggttggcg ctggcgggtg gtttgcccat ctttgatgcg
    2001  ttttacacct gttataagcg taacagcaac tcccactggt tcagtggccg
    2051  gaaaggaagg ttgaaaaccc tgtcaagtgt tgatgattcg ctcccctggt
    2101  tcatgcgcga gcttggactg aaagggaaaa ggtcgtcagc cgagccgtta
    2151  ccagcgtctc gtgccagctt ttacctcgca tggggggtca ccccctgtga
    2201  gcagttggag cttgagaaat attacaaatc gttcaaactg gacacgtcca
    2251  cattgcttga ggagcatttg tggcagcctc gcggggtgtt tcccgatgag
    2301  gattgagcac attgtggaag aaggtcacca cattaaatcc accctttacc
    2351  atggggcttg tcgttaaatt gccaaaacca atttgatggg ctgatataga
    2401  tgccaagaga ctgcacggca tactacgtcg acaagtgaac agtcccgttg
    2451  tgttgcggga tcccatacta acaatcgttc ctatgactct gaacttacgt
    2501  aaggtaccag catacctacc aggcaaagtt gacggagcgc tcactaattt
    2551  ggtgcacgcc gccgttgacc acgtggttcc tggattaggc aaagcagaga
    2601  aagctgcggc agtgtacaat atcaaacagg tcgttaagaa actcggtaca
    2651  tacaccgagc aaggcgtcaa gaaaatcgca aagaaaacgt tgggtgagtt
    2701  gggttatctc aattacaccc catcgtcaca tcttggcatg gctataaccg
    2751  gtcgaggtac aaaacaaatc aatatgtctc gcagcacaaa tgctggcggt
    2801  tttgccctcg gtggcaccac cgcagcgcca gtgtccatat cccgcaatat
    2851  caaccgccgc tccaagccca gcattaagat gatgggtgat gcggtggtta
    2901  tctcgcacag tgaaatgttg ggtgccatta attctggcac cccttcatcg
    2951  aatgtcaccg ctttccgttg cactggctac cgagctaatc ctgggatgtc
    3001  aactatcttc ccttggctgt ctgcaactgc cgttaattac gagaagtaca
    3051  aatttcgtag gctcagcttc actcttgtcc cgttggtttc taccaattat
    3101  agcggaagaa taggagttgg gtttgattac gattcgtctg acctcgtacc
    3151  tggcaacaga caggaatttt atgctctctc aaaccattgt gagaatatgc
    3201  cgtggcagga aagcactgtg gagattaaat gtgataatgc gtaccgattc
    3251  actggcactc atgttgcagc ggacaataag ctgattgacc tcggccaagt
    3301  cgtggtgatg tctgattctg tgtccaatgg tggcactatt tccgctgcgt
    3351  tgccgctttt cgacctgata gtcaattata ctgtggagct gattgaacct
    3401  caacaagcct tgttttcatc ccaactgtat agtggttcta ccacttttac
    3451  ctctgggata ccacttggca caggtgctga taccacaact gtggtcggtc
    3501  ccactgttgt aaactccaca actgtcacga actgtgtggt caccttcaag
    3551  ctgcccgctg gggtgtttga ggtgtcatat ttcattgcct ggtccacagg
    3601  aaccgctgct gttgtgccca ctgttcccac tactggggct gggtccaagt
    3651  tgtcgaacac atccactggc tccaactctt atggggtctg tttcataaac
    3701  agccccgttg agtgtgatct gttgcttacg gcaacggtac tgcttataat
    3751  tccaacctta ccaagttcaa cgtgtgtgtt tcacgcacct gctcgcaggt
    3801  gtacaacgcc tatgtgtcat aggttgctaa cgtctcttgc tggctgagac
    3851  attaataaat ggatccagta ggtcgtcaaa gcaaaccaac aaggcttgcc
    3901  ggggtggatg cgtagcgcag catgtctgtg ttggtacggc cacacccgga
    3951  gggacctcac cttgtaggca ggagtacacg actgttttct ttattgttgc
    4001  tcacaatgga aaatacaaaa ataggcttat caccatgatg gacacgccaa
    4051  aatattccag ccctggcgag tcgcggtcgc aatccgcagt ttattaaaac
    4101  ccttcggggt gggc