Sequence of DPV Carnation Italian ringspot virus

Carnation Italian ringspot virus genomic sequence for ORF1-5

ACC No: X85215

Dated: 2010-05-21 | Length: 4763 | CRC: 180590818

                
ID   X85215; SV 3; linear; genomic RNA; STD; VRL; 4763 BP.
XX
AC   X85215;
XX
DT   28-MAR-1995 (Rel. 43, Created)
DT   21-MAY-2010 (Rel. 104, Last updated, Version 10)
XX
DE   Carnation Italian ringspot virus genomic sequence for ORF1-5
XX
KW   capsid protein; movement protein.
XX
OS   Carnation Italian ringspot virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Tombusvirus.
XX
RN   [1]
RX   DOI; 10.1007/BF01322690.
RX   PUBMED; 7503699.
RA   Rubino L., Burgyan J., Russo M.;
RT   "Molecular cloning and complete nucleotide sequence of carnation Italian
RT   ringspot tombusvirus genomic and defective interfering RNAs";
RL   Arch. Virol. 140(11):2027-2039(1995).
XX
RN   [2]
RC   revised by [3]
RA   Russo M.;
RT   ;
RL   Submitted (10-MAR-1995) to the EMBL/GenBank/DDBJ databases.
RL   M. Russo, Centro Virus Virosi CNR Bari Italy, Via Amendola 165/A, I-70126
RL   Bari, ITALY
XX
RN   [3]
RC   revised by [4]
RA   Russo M.;
RT   ;
RL   Submitted (08-MAY-2008) to the EMBL/GenBank/DDBJ databases.
RL   M. Russo, Centro Virus Virosi CNR Bari Italy, Via Amendola 165/A, I-70126
RL   Bari, ITALY
XX
RN   [4]
RP   1-4763
RA   Russo M.;
RT   ;
RL   Submitted (19-MAY-2010) to the EMBL/GenBank/DDBJ databases.
RL   M. Russo, Istituto di Virologia  Vegetale del CNR, Unita Organizzativa di
RL   Bari,Via Amendola 165/A, I-70126 Bari, ITALY
XX
DR   RFAM; RF00171; Tombus_5.
DR   RFAM; RF00176; Tombus_3_IV.
DR   RFAM; RF00215; Tombus_3_III.
DR   RFAM; RF00510; Tombus_IRE.
XX
CC   Sequence overlapping with that submitted by M.Russo (Adv.Virus
CC   Res. vol.144: 381-428, 1994)
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .4763
FT                   /organism="Carnation Italian ringspot virus"
FT                   /mol_type="genomic RNA"
FT                   /db_xref="taxon:39443"
FT   CDS             78. .1070
FT                   /gene="orf1"
FT                   /function="unknown"
FT                   /db_xref="GOA:Q66100"
FT                   /db_xref="InterPro:IPR013707"
FT                   /db_xref="UniProtKB/TrEMBL:Q66100"
FT                   /protein_id="CAA59477.2"
FT                   /translation="MEGLKAESTTTVGINCNFQQTVMTETGNKLMFGSLPSSLERPVAK
FT                   RNYYRTLSDWILTYTKTGKIEDTHDNAWSYVEDLVKTDFNAKYDWLAKRGVARDYRTAV
FT                   GLAIIPGIPAIVANTRIVTGTCEVAGVAVKLPKALNMLSRFTHASVKVPYFYPRVDMSA
FT                   RGMLIGLAAAAALVPICAGIAYATLPREKLSVFRLKSEVRVHMEDEKEATDLLLVEPAR
FT                   ELKGKDGEDLLTGSRLTKVNARAGRPRRRPYAAKIAQVARAKVGYLKNSPENRLIYQRV
FT                   LIEIMDKDCVRYVDRDVILPLAIGCCFVYPDGVEESAALWGSQESLGVK"
FT   CDS             78. .2636
FT                   /transl_except=(pos:1068. .1070,aa:OTHER)
FT                   /gene="orf2"
FT                   /product="replicase"
FT                   /note="readthrough of stop codon"
FT                   /db_xref="GOA:Q66101"
FT                   /db_xref="InterPro:IPR002166"
FT                   /db_xref="InterPro:IPR007094"
FT                   /db_xref="InterPro:IPR013707"
FT                   /db_xref="UniProtKB/TrEMBL:Q66101"
FT                   /protein_id="CAA59478.2"
FT                   /translation="MEGLKAESTTTVGINCNFQQTVMTETGNKLMFGSLPSSLERPVAK
FT                   RNYYRTLSDWILTYTKTGKIEDTHDNAWSYVEDLVKTDFNAKYDWLAKRGVARDYRTAV
FT                   GLAIIPGIPAIVANTRIVTGTCEVAGVAVKLPKALNMLSRFTHASVKVPYFYPRVDMSA
FT                   RGMLIGLAAAAALVPICAGIAYATLPREKLSVFRLKSEVRVHMEDEKEATDLLLVEPAR
FT                   ELKGKDGEDLLTGSRLTKVNARAGRPRRRPYAAKIAQVARAKVGYLKNSPENRLIYQRV
FT                   LIEIMDKDCVRYVDRDVILPLAIGCCFVYPDGVEESAALWGSQESLGVKXGGLVRLPGV
FT                   VTQINRDIPSDVLLPQEVLEVRTGPPNAKDRNIFMVAGCPSQARFLVHNHCLKNLKRGL
FT                   VERVFCVERNGKLTRTPQPTKGAFGRLSPFRKAVCEKVGVAHRLGYDGFLSYYNGAKLR
FT                   TYTRAVESLHITPVSERDSHLTTFVKAEKISTSKGDPAPRVIQPRNPRYNVELGRYLRH
FT                   MESKLMKAVDGVFGETTCIKGYTADEVGAIFREKWDRFHKPVAIGLDASRFDQHCSVEA
FT                   LQYEHSFYRAMYPGNKLLGKLLDWQLHNKGKGYVPDGTITYRKEGCRMSGDINTSLGNY
FT                   LLMCAMVHGYMRHLGINEFSLANCGDDCVLILERRNLKQVQKTLPEYFLNLGYTMKVEP
FT                   PVFQLEEVEFCQAHPVQFQGGWKMVRNVRTAMSKDVHCVNNIRDLATRRAWSNAQHHGG
FT                   LALSAGIPVVERFYSRFALYDVPRKHQRIDTVTNVHKWRGSGGSYVVTPESRASFWAAF
FT                   GLTGDEQLALEDRLDRWEMDLFGEEGVDAHEPSILDSAVA"
FT   CDS             2648. .3808
FT                   /gene="orf3"
FT                   /product="capsid protein"
FT                   /db_xref="GOA:Q66102"
FT                   /db_xref="InterPro:IPR000937"
FT                   /db_xref="UniProtKB/TrEMBL:Q66102"
FT                   /protein_id="CAA59479.2"
FT                   /translation="MTMVLRNSGTMVPQGGNKMSKMAKNASQQGLQAGAAYLMSNPKGA
FT                   LKKGKDAWNYMTAGGVPSGIVHSGGMKGAIMAPVAVTRQLRGSKPKFSGRTSGSVTVSH
FT                   RELITQVNNSTQFVVNGGVTGNLRQVNPLNGTLFSWLPSIAANFDQYTFNSVTLHYVPL
FT                   CATTETGRVAMYFDKDSEDLEPADRVELANYATLKETAPWAEAMLRIPTDRIKRYNDDS
FT                   SVNDRKLIDLGQIGIATYGGSGTNPVGDVFISYSVTLHFPQPTAAGVQTRRLDLTSVLD
FT                   TNVGPSYTITSSTATVYTVAFRTVGTFMLFGAVRSTGSPVIGLSSANIAINSNTTLNTA
FT                   GTAFSYMTNVTVSALPASITFTVVGVITSSTSHAVRASRTNNADMI"
FT   CDS             3843. .4412
FT                   /gene="orf4"
FT                   /product="movement protein"
FT                   /db_xref="GOA:Q66103"
FT                   /db_xref="InterPro:IPR005332"
FT                   /db_xref="UniProtKB/TrEMBL:Q66103"
FT                   /protein_id="CAA59480.1"
FT                   /translation="MDTEYEQVNKPWNELYKETTLGNKLTVNVGMEDQEVSLLPSNFLT
FT                   KVRVGLSGGYITMRRIRIKIIPLVSRKAGVSGKLYLRDISDTTGRKLHCTESLDLGREI
FT                   RLTMQHLDFSVPTRSDVPIVFGFEELVSPFLEGRELFSISVRWQFGLSKNCYSLPQSKW
FT                   KVMYQEDALKVLKPSRKKASKTDSSV"
FT   CDS             3875. .4393
FT                   /gene="orf5"
FT                   /function="unknown"
FT                   /db_xref="GOA:Q66104"
FT                   /db_xref="InterPro:IPR004905"
FT                   /db_xref="PDB:1RPU"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q66104"
FT                   /protein_id="CAA59481.1"
FT                   /translation="MERAIQGNDTREQANGERWDGGSGGITSPFKLPDESPSWTEWRLY
FT                   NDETNSNQDNPLGFKESWGFGKVVFKRYLRYDRTEASLHRVLGSWTGDSVNYAASRFLG
FT                   ANQVGCTYSIRFRGVSVTISGGSRTLQHLCEMAIRSKQELLQLTPVEVESNVSRGCPEG
FT                   IETFKKESE"
XX
SQ   Sequence 4763 BP; 1256 A; 992 C; 1303 G; 1212 T; 0 other;

x85215 Length: 4763  21-MAY-2010  Type: N  Check: 6480  ..

       1  agaaatatct caggatttga ccgtccggtg agttgcgctt atcacttgcg
      51  taaggtattt ctctcttcat tgttcatatg gagggtttga aggctgagtc
     101  taccacaact gtggggataa attgtaactt tcagcaaaca gtgatgactg
     151  agaccggtaa taagttgatg ttcggaagtt taccttcaag tttggaacga
     201  cccgttgcaa agaggaacta ttatcgtaca ttatcggact ggattttaac
     251  gtacactaag acagggaaaa tcgaggatac acatgataat gcttggagtt
     301  atgtcgagga tcttgtcaag actgacttca atgctaaata tgattggttg
     351  gctaaacggg gtgtggctcg tgattaccgc actgccgtgg ggttggccat
     401  catacctggt atcccggcga ttgtggcaaa cacacgcatt gttactggta
     451  catgtgaggt ggcaggggtt gctgtaaagc tgcccaaggc gctgaacatg
     501  ctttctagat tcacacatgc gagtgtcaaa gtaccgtact tttatccacg
     551  tgtggacatg agtgcgcgtg gcatgctcat tggcctggcg gcggctgcag
     601  cacttgttcc tatttgtgct ggcattgcgt acgctaccct ccccagggaa
     651  aaactgtctg tgtttaggtt gaaatcagag gttcgtgttc atatggagga
     701  tgagaaagaa gcaacggact tgttgttggt tgagcctgct cgggagctca
     751  agggtaagga tggtgaggat ctcctcactg gtagtagatt aactaaggtg
     801  aacgcgcgcg cggggcgccc tcgtagaagg ccttatgcag ctaaaattgc
     851  acaggtcgcg agagccaagg tgggttacct taagaatagt cctgaaaata
     901  gactaatcta ccagcgagtg ctgattgaaa tcatggacaa ggactgcgtc
     951  aggtatgttg acagggatgt catattgcct ttggctattg gatgctgttt
    1001  tgtctatcct gatggagtgg aggagtcggc ggcactttgg ggttcccagg
    1051  aatccctcgg tgtcaaatag ggaggcctag tgcgtctacc tggggtcgta
    1101  acacagatca atcgagatat cccatctgat gtgttgctcc cccaggaagt
    1151  gctagaggtt cgtacaggac ctcccaatgc taaggaccgt aatatattta
    1201  tggttgcagg ttgcccatca caggcacggt tcttagtaca taatcactgc
    1251  ctgaaaaacc tcaaaagggg tcttgtggag agagttttct gcgtagagag
    1301  aaacgggaag ctcactcgca ctccacaacc taccaaagga gcttttggac
    1351  gtctttcccc gttcaggaaa gcagtttgtg agaaggttgg ggtcgcccac
    1401  cgacttgggt atgatggatt tctgtcatac tacaacggtg cgaaactccg
    1451  tacttacaca cgggctgtgg agagtctgca tatcactcct gtctcggaga
    1501  gggatagtca tctgactacc ttcgtcaagg cagagaagat atcgacgtct
    1551  aaaggtgacc cagcacctag ggtgattcag cctcgaaacc ctaggtacaa
    1601  tgtcgaactt ggaagatatc tacggcatat ggaatccaag ctgatgaaag
    1651  ctgttgatgg cgtattcgga gagacgacgt gcattaaggg atacacagcc
    1701  gatgaggtgg gtgcaatttt tcgggagaag tgggataggt ttcataagcc
    1751  tgtcgccatt ggtctcgatg catccaggtt tgatcaacac tgttccgttg
    1801  aggctttgca gtatgagcat agcttctaca gggccatgta ccctggcaac
    1851  aagctcttgg gcaagttgtt ggactggcaa ctccacaata aagggaaagg
    1901  ttatgttcct gatggaacta taacctaccg caaggagggg tgccgtatga
    1951  gtggggatat aaacacttcg ttgggaaatt atctattgat gtgcgctatg
    2001  gtacacgggt acatgcgtca tttggggatt aatgagttta gtctggcaaa
    2051  ctgtggggat gactgtgttc ttatactaga acgcagaaat cttaagcagg
    2101  tgcagaagac cctaccggag tatttcctta atttgggata cactatgaag
    2151  gtggagccgc ctgtatttca attggaagag gttgaatttt gccaggcaca
    2201  ccccgtacag tttcaaggtg gttggaagat ggtccgaaat gtccgcactg
    2251  cgatgagcaa ggatgtgcat tgtgtcaata atatacgcga tctggcgacg
    2301  aggagagcat ggagtaatgc tcaacaccac ggtggattag cactcagtgc
    2351  tggtatacct gtggttgaga ggttctactc caggttcgca ctatatgatg
    2401  tgcctcgtaa gcatcaacgc attgacactg tcactaatgt tcacaagtgg
    2451  cgtggatctg gtggaagtta tgttgtgact cctgaatcta gggctagctt
    2501  ttgggctgcc ttcgggttga cgggggatga gcaactagct ttggaggacc
    2551  gtctggatag atgggagatg gatctgtttg gagaggaggg tgttgacgct
    2601  catgagccca gcatcctcga ctccgccgta gcttgaccaa gcgagacatg
    2651  acaatggtac taagaaattc aggcacaatg gtgcctcaag gcggcaataa
    2701  aatgagtaag atggcgaaga atgcatccca acaaggacta caagcagggg
    2751  ctgcttatct gatgagcaac cctaaggggg cattaaagaa agggaaagac
    2801  gcatggaatt acatgacagc agggggtgtg ccaagtggta tagtacactc
    2851  agggggaatg aaaggcgcga ttatggcgcc cgtggcagtt accagacagt
    2901  taagggggag taaacctaaa ttctccggaa ggacatctgg ttccgtgaca
    2951  gtgagtcata gagagctaat tacgcaagtg aacaactcaa cgcagtttgt
    3001  ggttaatggt ggtgttactg gcaaccttag gcaagttaat cccttaaatg
    3051  ggaccttgtt ctcatggcta cctagcattg ctgctaactt tgatcagtac
    3101  acattcaata gtgttacgtt gcattacgta cctttatgtg ctacgaccga
    3151  aactgggcga gttgcgatgt atttcgacaa agattccgag gacctcgagc
    3201  ctgcggacag agtagagctt gctaattatg ctacattgaa agaaactgca
    3251  ccatgggccg aggccatgtt acgtatacca accgatcgta tcaaacggta
    3301  taacgatgac agcagcgtaa atgatcgcaa attgattgac ctgggacaga
    3351  taggtattgc aacatatggt ggttcgggca caaaccctgt tggggatgtg
    3401  ttcatatctt acagtgttac tttgcacttc ccacaaccca ctgcagccgg
    3451  tgtgcagaca cggcgtctcg atctcacaag tgttttagac acaaatgtcg
    3501  gacctagtta cactatcacg tccagtactg ctacggtgta cacagttgct
    3551  ttccgcactg tgggcacctt tatgctgttt ggagccgtga ggtcaactgg
    3601  gtcacccgtt atcggactgt ctagtgcgaa cattgctatt aatagcaaca
    3651  ccacattgaa cacagccggt actgctttct cctacatgac gaacgttacg
    3701  gtgtctgctt tgccagcatc cattacgttt actgtagttg gggtaattac
    3751  ctcgtcaact tcacatgccg tgagagcatc acgcactaat aacgcagaca
    3801  tgatatagta ccattgaggg gcctcttgaa caagaccagt tcatggatac
    3851  tgaatacgaa caagtcaata aaccatggaa cgagctatac aaggaaacga
    3901  cactagggaa caagctaacg gtgaacgttg ggatggagga tcaggaggta
    3951  tcacttctcc cttcaaactt cctgacgaaa gtccgagttg gactgagtgg
    4001  cggctatata acgatgagac gaattcgaat caagataatc cccttggttt
    4051  caaggaaagc tggggtttcg ggaaagttgt atttaagaga tatctcagat
    4101  acgacaggac ggaagcttca ctgcacagag tccttggatc ttggacggga
    4151  gattcggtta actatgcagc atctcgattt ctcggtgcca accaggtcgg
    4201  atgtacctat agtattcggt ttcgaggagt tagtgtcacc atttctggag
    4251  ggtcgagaac tcttcagcat ctctgtgaga tggcaattcg gtctaagcaa
    4301  gaactgttac agcttacccc agtcgaagtg gaaagtaatg tatcaagagg
    4351  atgccctgaa ggtattgaaa ccttcaagaa agaaagcgag taagacagac
    4401  tcttcagtct gagttcgctg aaacgagtgt aaatctggca tagcatacag
    4451  gttactcttg ttgggttcta gatgttatga tgacgagtcg gttcgggctc
    4501  cgcactaggt ttggtcacct aggggatgga gatatggaaa gggtctcgtg
    4551  tgctgttaga cggtcgtaag acgcgcttgc aacatgggcc tatgaccgga
    4601  taagtcatag caatactagc caacatgaat aggattcctg tttacgaaag
    4651  ttagatgtca cttgtggaaa cggacccaga cacggttgat ctcaccttcg
    4701  ggggggctat agagatcgct ggaagcacta ccggacaacc ggaacattgc
    4751  agaaatgcag ccc