Sequence of DPV Olive latent virus 1

Olive latent virus 1 complete genome

ACC No: X85989

Dated: 1996-08-28 | Length: 3699 | CRC: -1941716038

                !!NA_SEQUENCE 1.0
ID   OLV1GENOM  standard; RNA; VRL; 3699 BP.
XX
AC   X85989;
XX
SV   X85989.1
XX
DT   17-MAY-1996 (Rel. 47, Created)
DT   28-AUG-1996 (Rel. 49, Last updated, Version 6)
XX
DE   Olive latent virus 1 complete genome
XX
KW   capsid protein; RNA dependent RNA polymerase gene.
XX
OS   Olive latent virus 1
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Necrovirus.
XX
RN   [1]
RA   Grieco F., Savino V., Martellli G.P.;
RT   "Nucleotide sequence of the genome of a citrus isolate of olive latent
RT   virus 1.";
RL   Arch. Virol. 141:825-838(1996).
XX
RN   [2]
RP   1-3699
RA   Grieco F.;
RT   ;
RL   Submitted (30-MAR-1995) to the EMBL/GenBank/DDBJ databases.
RL   F. Grieco, CNR, Centro Studio Virus e Virosi, Univ. of Bari, Via Amendola
RL   165/A, I- 70126 Bari, ITALY
XX
DR   SPTREMBL; Q83938; Q83938.
DR   SPTREMBL; Q83939; Q83939.
DR   SPTREMBL; Q83940; Q83940.
DR   SPTREMBL; Q83941; Q83941.
DR   SPTREMBL; Q83942; Q83942.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .3699
FT                   /db_xref="taxon:47669"
FT                   /organism="Olive latent virus 1"
FT                   /strain="citrus"
FT   CDS             61. .2232
FT                   /db_xref="SPTREMBL:Q83938"
FT                   /note="ORF2"
FT                   /transl_except=(pos:664. .666,aa:OTHER)
FT                   /product="RNA dependent RNA polymerase"
FT                   /protein_id="CAA59977.1"
FT                   /translation="MELPNQHKQTAAEGFVSFLNWLCNPWRRQRTVNAAVAFQNSILAI
FT                   EDVEHFEDINECFEESSGGQSQRTKVVAEGAYSPVKSERTRRVRKQKAKFVKYLVNEAR
FT                   AEFGLPKATEANRLMVQHFLLRRCKDWGVVTSQCHNNVALALTLVFVPTGDDLLARVVM
FT                   NTYKTRSAVRGMDNLQGEGWWNNRLGIGGQAGLAFRAKXGCLERRPGFSTSVSRGNHPD
FT                   LVVKPSGHPEKQRQLLRYSGIGGHLLIGIHNNSLSNLRRGLMERVFYVEGPNGLQDPPK
FT                   PVRGAFNSLNKFRDLYTKNSWRHSPVTNEQFLMNYSGRKLTIYKEAVDSLSHQPLSLRD
FT                   SRLKTLLKAEKLNLSKKPHPAPRVIQPRSPRYNVCLGRYLRHYEHHAFKTIAKCFGEIT
FT                   VFKGFTLEQQGEIMFSKWKKYVKPVAVGLDASRFDQHVSWEALQYEHEFYIRDYPNDKQ
FT                   LKWLLKQQLSNIGTAFASDGIIKYKKEGCRMSGDMNTSLGNCILMCAMVYGLKEHLGIN
FT                   LSLANNGDDCVIVCEKADLKKLTSSIEPYFRQFGFKMEVEKPVDIFERIEFCQTQPVFD
FT                   GSQYIMVRKPSVVTSKDVTSLIPCQNEAQYAEWLQAVGECGMSINGGIPVMQNFYQMLQ
FT                   TGVKRTKFTKTGEFQTNGLGYHSRYMHRVAQTISPETRLSLYLAFGITPDLQEALEVFY
FT                   DTHTLELDDVVPVDTYQVSGEHLINGLPN"
FT   CDS             61. .666
FT                   /db_xref="SPTREMBL:Q83939"
FT                   /note="ORF1, unknown function"
FT                   /protein_id="CAA59978.1"
FT                   /translation="MELPNQHKQTAAEGFVSFLNWLCNPWRRQRTVNAAVAFQNSILAI
FT                   EDVEHFEDINECFEESSGGQSQRTKVVAEGAYSPVKSERTRRVRKQKAKFVKYLVNEAR
FT                   AEFGLPKATEANRLMVQHFLLRRCKDWGVVTSQCHNNVALALTLVFVPTGDDLLARVVM
FT                   NTYKTRSAVRGMDNLQGEGWWNNRLGIGGQAGLAFRAK"
FT   CDS             2216. .2440
FT                   /db_xref="SPTREMBL:Q83940"
FT                   /note="ORF3, unknown function"
FT                   /protein_id="CAA59979.1"
FT                   /translation="MDYQTEVSEDNVSVRGRARRGTEDKKHNGSGLTGVKRHAVSETSQ
FT                   KSQSRYWSNGTMTNIAEEQTITVTYNFNF"
FT   CDS             2443. .2613
FT                   /db_xref="SPTREMBL:Q83941"
FT                   /note="ORF4, unknown function"
FT                   /protein_id="CAA59980.1"
FT                   /translation="MAVCRCCDTSPGITLFPYFAILILILAILVVGTPNQQYHHSPSTY
FT                   EYKTQHISIAK"
FT   CDS             2635. .3447
FT                   /db_xref="SPTREMBL:Q83942"
FT                   /note="ORF5"
FT                   /product="capsid protein"
FT                   /protein_id="CAA59981.1"
FT                   /translation="MVNFYWDSRIQRWFYESGPQRVRTYIKRISPHQMASLPARKTKRS
FT                   PPNRGNLQVLPVIAPVAGGVISTEGHVPRITTTNEQTVVRNTEIISAINSAALGAIFGN
FT                   YVTVIPSNLSWLAGLSDLYSKYRWRKLRFIYLPVCPTSTQGNVSMSLSFDRIDTQPTSI
FT                   TQMQQGYRAITFPPYAGYDGAMALASFGNIPGMVVVDVDCARMDKLWYPNVTLATFLAM
FT                   APTSRTDTCGVTLFTASDQGPAAATNFGQVFCQYEIEFIEPVNPTVNL"
XX
SQ   Sequence 3699 BP; 1006 A; 873 C; 904 G; 916 T; 0 other;

X85989  Length: 3699  December 21, 2001 16:03  Type: N  Check: 6860  ..

       1  tagtatacat accaagtata cggatatcgg tgcgagccct gcacagctaa
      51  agtgtataaa atggagttac ccaaccaaca taagcaaact gctgctgaag
     101  gtttcgtttc tttccttaac tggctttgta acccctggag acgccaacgt
     151  acagtcaacg ctgctgtcgc cttccagaat agcattcttg ctattgagga
     201  cgtagaacac ttcgaagata tcaacgagtg ttttgaggaa tcgtctggag
     251  gccaatcgca gcgcactaag gttgtcgccg aaggggctta ctctcccgta
     301  aaatccgaac gcacccgccg agtccgcaag caaaaggcca aattcgtcaa
     351  atatttggtc aatgaggctc gtgccgagtt tggtctcccc aaagctacag
     401  aggccaatcg actcatggtg caacacttcc tgctccgaag gtgtaaggat
     451  tggggggttg tcacatccca gtgccacaac aatgttgcac tcgccttgac
     501  tctcgtgttt gtcccaacag gggatgattt gctggcgcga gtagtgatga
     551  acacgtacaa gacgaggtct gcggtccgtg ggatggacaa cctccaaggg
     601  gaggggtggt ggaacaacag gcttggcata ggtggccagg ccggcttggc
     651  ctttcgggcc aaataggggt gcctagagag gaggccgggg ttttccacgt
     701  ccgtttcgcg tgggaatcac cccgatctgg tggtcaaacc atcaggacac
     751  cccgagaaac agcgtcagtt gttacgctat agtggaattg gcggccattt
     801  attaatcggc atccacaaca actctctctc caatttgcgt aggggcttaa
     851  tggagagagt tttctacgtc gagggaccca atgggctcca agacccccct
     901  aaacccgttc ggggagcttt caactccctg aataagtttc gagacctata
     951  taccaaaaat agttggcgtc attcccctgt aaccaatgaa caattcttga
    1001  tgaattactc gggcaggaaa ctaactattt acaaagaagc ggttgatagt
    1051  ttgtcgcatc aaccacttag cttacgggac tcgaggctga agactttact
    1101  taaggccgaa aaactcaatc tgagcaaaaa gccacatcca gcaccccggg
    1151  ttatccaacc caggtcaccc cggtacaacg tttgtttggg tcgttatcta
    1201  cgtcactatg aacaccacgc gttcaaaacc attgctaaat gctttgggga
    1251  gatcacggtc tttaaagggt ttactctaga gcaacaaggc gaaatcatgt
    1301  tctcgaagtg gaagaaatat gttaagcccg tcgccgtcgg actcgatgca
    1351  agtcggttcg accaacacgt gtcatgggaa gcacttcaat acgagcatga
    1401  attttacatt agagattacc cgaatgataa acagctaaaa tggttgttga
    1451  agcaacaact gagcaatatt ggcacagcgt ttgctagtga tggcatcata
    1501  aagtataaga aggagggttg tcgtatgagt ggagatatga acaccagttt
    1551  gggcaattgc attctcatgt gtgcgatggt atacgggttg aaggaacacc
    1601  tgggcataaa tttatccctt gccaataatg gggatgactg cgtcattgtc
    1651  tgtgagaaag cggatttgaa gaaattgaca agcagcatcg aaccatattt
    1701  caggcaattt ggattcaaaa tggaggtgga aaaacccgtg gacatatttg
    1751  aacgcattga gttttgccaa acccaacctg tgtttgatgg gtcccaatac
    1801  atcatggttc gaaaaccctc ggtagtcaca tcgaaggatg tcactagctt
    1851  aatcccatgc caaaatgagg ctcaatatgc agaatggctg caagctgtag
    1901  gtgagtgtgg aatgagtatt aatggtggaa ttcctgttat gcagaatttt
    1951  taccaaatgc tccaaactgg agttaaacgc accaaattca ccaagaccgg
    2001  cgagtttcag acgaacgggt tggggtatca ctctagatat atgcatagag
    2051  tggcccagac catttcgccc gaaacccgtt tatccttgta tttagcgttc
    2101  ggtatcacac cagaccttca ggaagcactg gaggtcttct atgataccca
    2151  cacgcttgag ttggatgatg ttgtcccagt tgatacctac caagtatcag
    2201  gagagcattt gatcaatgga ttaccaaact gaggttagtg aggataacgt
    2251  gagcgtacgc ggtcgggcta ggagggggac tgaggataag aagcacaacg
    2301  gatcgggctt aactggcgtt aagcgtcatg cggtgagtga aacatctcag
    2351  aaatcacagt caaggtactg gtcaaacggc acaatgacca acatagctga
    2401  agagcagacc attaccgtga catacaactt taacttttag ttatggctgt
    2451  gtgtcgctgt tgtgatactt caccaggtat tacattattc ccttacttcg
    2501  ctattcttat tctcatcctt gcaatattag ttgttggtac tccaaatcag
    2551  caatatcatc attctcctag tacttacgag tataagactc aacacatttc
    2601  gatcgcaaaa tagacatttc gcaactctct caacatggtt aatttttact
    2651  gggatagtcg aattcagagg tggttctacg aaagtggacc acagcgtgtc
    2701  cgcacttata taaagcggat ttcaccccac caaatggcaa gtctgcctgc
    2751  tcgcaagact aaaaggtcac ccccaaatag gggcaaccta caagttcttc
    2801  cggttatagc acccgttgct ggtggagtga tttctacaga agggcacgtt
    2851  cctcgaatta ctactactaa tgagcagact gtcgtgagaa acacagaaat
    2901  cataagtgcc atcaactctg ccgctctagg tgccattttc ggcaactacg
    2951  tcacggtaat cccgtccaat ctatcatggt tggcaggttt gtccgatttg
    3001  tacagcaagt accgatggcg caaactccgg ttcatttatc taccggtttg
    3051  cccaaccagc acacaaggca atgtttctat gtcactatca ttcgacagaa
    3101  tcgatacgca gccaacaagc atcactcaaa tgcaacaggg ttaccgtgcc
    3151  attacttttc cgccttacgc ggggtatgat ggtgctatgg ccttagcgtc
    3201  attcggcaac attcctggaa tggttgtcgt ggacgtggac tgcgctcgaa
    3251  tggacaagtt gtggtaccct aatgttaccc tggccacctt tctggccatg
    3301  gcaccaacat ccagaacgga tacctgcgga gttaccctgt ttactgcaag
    3351  tgatcaaggg ccagccgctg ccaccaactt tggccaggtg ttctgccagt
    3401  atgaaatcga atttatagaa ccagtgaacc caactgtcaa tttgtaacca
    3451  cacaacgatg ggtgagttac gtaactgtgc taatccctaa aagttttagt
    3501  agagcggtaa gcaatccgga tcctggtaga caggtttaac gggctggggg
    3551  tggtgccccg gccgtcgcat cacttgctga tacaatctac aagactcatg
    3601  ggagggtctg cacaggtatc cacgccgagg acgggacgaa agtctcggac
    3651  ggggggtagt ggacccaaca ccagattgag gggcttttgc cccacccca