Sequence of DPV Pothos latent virus

Pothos latent virus genes for replicase, capsid protein and movement protein

ACC No: X87115

Dated: 2005-04-18 | Length: 4415 | CRC: -58495865

                !!NA_SEQUENCE 1.0
ID   PLVRNARCM  standard; genomic RNA; VRL; 4415 BP.
XX
AC   X87115;
XX
SV   X87115.1
XX
DT   13-DEC-1995 (Rel. 46, Created)
DT   18-APR-2005 (Rel. 83, Last updated, Version 3)
XX
DE   Pothos latent virus genes for replicase, capsid protein and movement
DE   protein
XX
KW   capsid protein; movement protein; readthrough protein; replicase.
XX
OS   Pothos latent virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Aureusvirus.
XX
RN   [1]
RX   MEDLINE; 96068817.
RX   PUBMED; 7595391.
RA   Rubino L., Russo M., Martelli G.P.;
RT   "Sequence analysis of pothos latent virus genomic RNA";
RL   J. Gen. Virol. 76:2835-2839(1995).
XX
RN   [2]
RP   1-4415
RA   Russo M.;
RT   ;
RL   Submitted (09-MAY-1995) to the EMBL/GenBank/DDBJ databases.
RL   M. Russo, Centro Virus Virosi CNR Bari Italy, Via Amendola 165/A, I70126
RL   Bari, ITALY
XX
CC   Overlaps teh submitted by Russo M. Adv. Virus Res.
CC   144:381-428,1994
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .4415
FT                   /db_xref="taxon:44562"
FT                   /mol_type="genomic RNA"
FT                   /organism="Pothos latent virus"
FT   CDS             141. .809
FT                   /db_xref="UniProt/TrEMBL:Q84830"
FT                   /gene="orf"
FT                   /function="unknown"
FT                   /protein_id="CAA60595.1"
FT                   /translation="MANWCVKVLMFPFVTVYTIVTSLGRGIRRGFRACVDEVENIYGDM
FT                   CAGFRVALSKLSVSWIVVVGMIFVLNSLVVGLVPTLTMAAIIAACVGAKYGGRVPRYIR
FT                   AHVDRIRKSWEKGVDDDDCCAPLPETSLERVPVKLRPRLACKIAVRAIAKVGLLKRSEA
FT                   NSMVYQRVCLDVMESMKMRWHDRLVILPQAVLACLERPEEVEEVMKAIEASCKGPFDVY
FT                   "
FT   CDS             141. .2363
FT                   /db_xref="GOA:Q84831"
FT                   /db_xref="InterPro:IPR002166"
FT                   /db_xref="InterPro:IPR007094"
FT                   /db_xref="InterPro:IPR007095"
FT                   /db_xref="UniProt/TrEMBL:Q84831"
FT                   /note="readthrough stop codon"
FT                   /transl_except=(pos:807. .809,aa:OTHER)
FT                   /product="replicase"
FT                   /protein_id="CAA60596.1"
FT                   /translation="MANWCVKVLMFPFVTVYTIVTSLGRGIRRGFRACVDEVENIYGDM
FT                   CAGFRVALSKLSVSWIVVVGMIFVLNSLVVGLVPTLTMAAIIAACVGAKYGGRVPRYIR
FT                   AHVDRIRKSWEKGVDDDDCCAPLPETSLERVPVKLRPRLACKIAVRAIAKVGLLKRSEA
FT                   NSMVYQRVCLDVMESMKMRWHDRLVILPQAVLACLERPEEVEEVMKAIEASCKGPFDVY
FT                   XGCLLQHRGYNTAITSVIPDGVLLNHEGMVVRKGAPITNERRWYSFAGYASTYEYIVHN
FT                   SSLVNVCRGLVERVFCVVRDGKLQRPLRPKNNVFERKLGNIGRKISSIVGYCPAMTRSE
FT                   FCDSYSGTRRATYERARLSLDVLPCTRKDAYLKTFVKAEKINITLKPDPAPRVIQPRDP
FT                   RINVEVGRYLKPLEPRLMKAIDKLWGEKTAIKGYTVEKVGEILHQKSLRFKNPCFVGLD
FT                   ASRFDQHCSRQALEWEHSVYNAIFRDPYLSELLTWQIDNVGTAYLKDGFVRYRVDGCRM
FT                   SGDMNTSMGNYLIMSCLVYQFCKDIGVDASLANCGDDCVLYLEKEDLPKLKALPDWFEK
FT                   MGYSMKVEKPVFTVEEIEFCQQHPVQLSRGYVMVRRPDVCLTKDLLPFVRGGMTTERLQ
FT                   RWLYAQHDGGLALAGDCPVLGAFYQRFPSGESHGELSEYSDAHKFKAGKQYGEITSLAR
FT                   YSFWLAFGITPDEQLAIERDLMNWTPNVVLGSCDPRPTLLDYCSDN"
FT   CDS             2375. .3496
FT                   /db_xref="GOA:Q84832"
FT                   /db_xref="HSSP:2TBV"
FT                   /db_xref="InterPro:IPR000937"
FT                   /db_xref="UniProt/TrEMBL:Q84832"
FT                   /product="capsid protein"
FT                   /protein_id="CAA60597.1"
FT                   /translation="MALVKRNNNMALIASEAGKLAAIKAGQVMLSPAGRELIWNGVNWV
FT                   RRKLGRSKKSDVILHPGVLPGAIAAPVANTRIIRASKPKFTRSKGSVTIAHRELLGQFN
FT                   NSSGLVVNGGVSGNVYRINPSNPVVFPWLQGIAASFDQYKFDRVQLQYVPMCATTETGR
FT                   VAIYFDKDSQDVEPADRDELAIMAHLTESAPWCESTLSIPVDNIKRFMNDNTTTDPKLV
FT                   DLGQIGLATYGGGSTNPVGDLFIHYTITLFEPQPLASLVETEQTGTGAAPFGANLVTVS
FT                   SNATITIYTFEGPGVYLLALSQRAASFTTFVTAGGAVVNSHTTTITSGPAYQSICEYYC
FT                   CYTWGSITYNGTLFGNYTLQVTRAKISNNATLI"
FT   CDS             3591. .4319
FT                   /db_xref="GOA:Q84833"
FT                   /db_xref="InterPro:IPR005332"
FT                   /db_xref="UniProt/TrEMBL:Q84833"
FT                   /product="movement protein"
FT                   /protein_id="CAA60598.1"
FT                   /translation="MEIQSLDGILGEELAIQNEVKKILLSHKTTKAILPLAPISQFSKW
FT                   KIPKQGFYAPIDVKFVLTPHISERAQVRGVVKLVDSRDLSPSRELYRSKEFNIGHGLVI
FT                   EGSQLPFCLPVGDYPLQFEVTVLQSQFRETANLYSTSVEWRMMSSTTPLSRVRSVMGAA
FT                   QQPAMKLQPNFKMSLESSKGGGMKSHQKKNSKPNGHSRRGNLSGEVGGSSSSLPSGAQT
FT                   GEWIDNDYGDSLSEYSGVSA"
FT   CDS             3722. .4114
FT                   /db_xref="UniProt/TrEMBL:Q84834"
FT                   /gene="orf"
FT                   /function="unknown"
FT                   /protein_id="CAA60599.1"
FT                   /translation="MENSQTGVLCPNRCQVCSHTTYIRESSGQGGRQACRFTRFVTQPR
FT                   VVSEQGIQYRSWLSDRGFPITLLSTSGGLSTTIRGHGVAITIQGDSKSLLNFCRVAYDV
FT                   FHHPVVQSEVCHGSGPATSDEITTKF"
XX
SQ   Sequence 4415 BP; 1129 A; 937 C; 1143 G; 1206 T; 0 other;

   X87115  Length: 4415  May 10, 2005 10:10  Type: N  Check: 9736  ..

       1  agaataacta ctataagcct aaccagcttg ttgagagttg tggagccatc
      51  catatagtta ttctctcgct cagcttttgt tgtgtgggtt tgaaggacca
     101  gtctatcact ttgtgaggat aaattgtaac tgtggtcaaa atggcgaatt
     151  ggtgtgtgaa agttcttatg tttcctttcg ttactgttta cacgattgtg
     201  acttcccttg ggcggggcat tcgacgcggc tttcgagcct gtgtggatga
     251  agttgagaac atctatggag acatgtgtgc tggattcagg gttgccctga
     301  gcaaacttag tgtctcctgg atagttgtcg tgggcatgat atttgttctt
     351  aacagtctcg tggtaggcct cgttcctacc ctgaccatgg ctgctattat
     401  tgcggcctgt gtcggggcaa agtacggggg tcgtgttcca cgatacattc
     451  gggcccatgt ggacagaata cgaaaatcct gggagaaagg ggtagatgac
     501  gatgactgtt gtgctccgtt acctgaaaca tccctcgaga gggtgcccgt
     551  taagcttagg cctagactag cttgtaagat tgctgttagg gccatagcca
     601  aggtggggct acttaagagg agtgaggcca actccatggt ttaccagaga
     651  gtgtgcctcg atgtcatgga aagcatgaaa atgcggtggc acgacaggct
     701  cgtcatcctc cctcaagcgg ttcttgcttg cctggagagg ccagaggaag
     751  tcgaagaagt catgaaagcc attgaggcgt cctgcaaggg accgtttgat
     801  gtctactagg ggtgcctatt acaacaccgt ggttataaca ctgccatcac
     851  tagcgtcata ccagatggag tgttattgaa ccacgaaggg atggtggtac
     901  gtaaaggagc ccctatcacc aatgaacgaa gatggtactc atttgctggg
     951  tatgccagta cctacgagta cattgtgcat aattcatcac ttgtcaacgt
    1001  ttgtcgtggt ttagttgaac gagtgttttg cgtcgtgcga gacggtaaat
    1051  tgcagcgacc tctgcgcccc aaaaataatg tttttgagag gaagcttggt
    1101  aatattggtc gtaaaatcag ctcaattgtt gggtactgcc ccgctatgac
    1151  acgcagtgaa ttctgtgatt cttatagcgg cacgcgacgt gccacgtatg
    1201  agcgagcaag attgtccttg gatgttctcc cctgtacccg caaagatgct
    1251  tatctgaaga cttttgttaa ggcggagaag atcaatatta cacttaaacc
    1301  cgaccccgca ccccgggtca ttcagccacg tgaccccagg atcaatgtgg
    1351  aagtgggacg ttacttgaag cctcttgaac ccagattgat gaaggctatt
    1401  gataaattat ggggggaaaa gacggcaatt aagggataca cagttgagaa
    1451  ggttggggag atcttacacc agaaatcact taggtttaag aacccatgct
    1501  ttgttggtct tgacgcttca cgttttgacc agcactgttc caggcaggca
    1551  cttgagtggg aacattcagt gtacaatgcc attttccggg atccttactt
    1601  atccgaactg ttgacttggc agattgacaa tgttggtact gcttatctaa
    1651  aagatgggtt tgtgaggtat cgtgtagatg gttgccgtat gtctggggac
    1701  atgaacacta gcatgggtaa ttacctcatc atgtcttgtt tggtctacca
    1751  gttttgtaag gacattggcg ttgacgctag tcttgccaat tgtggtgatg
    1801  actgtgtact ctatttggag aaggaggacc tacctaagct gaaggcacta
    1851  cctgattggt ttgaaaagat ggggtattct atgaaggtgg aaaaacccgt
    1901  ctttaccgtt gaggaaattg agttttgcca acaacacccc gtgcagctta
    1951  gtagaggtta tgtaatggtt aggcggccag acgtctgttt gacaaaagat
    2001  ttgttgccgt ttgtccgtgg aggtatgaca acggagagac tccagcgttg
    2051  gttgtatgct caacacgatg gtggattggc ccttgcgggt gattgccctg
    2101  tgttgggagc gttttaccaa cgttttccca gtggtgagtc ccatggggag
    2151  ttgtctgaat attctgacgc acataagttt aaggccggta agcagtatgg
    2201  agaaatcaca agtcttgctc gttatagttt ctggttggcc ttcggcatca
    2251  cgccggatga gcaacttgct atagagcgcg acctaatgaa ttggactccc
    2301  aatgtggtgc ttggttcttg tgacccacgg cccacattgt tggactactg
    2351  ctcagataac tgaccattat caccatggca ctcgtgaaac gaaataataa
    2401  tatggcgttg attgcttccg aagcagggaa gttagcagct attaaagctg
    2451  gacaagttat gcttagtcca gcgggaagag aattgatttg gaatggcgtg
    2501  aattgggttc gacggaagtt agggagatct aagaagtcag atgttattct
    2551  ccacccaggt gttttaccag gtgccattgc tgcgcctgta gctaataccc
    2601  ggatcatcag agcatccaag cctaagttca cacgtagcaa gggatctgta
    2651  actattgccc atcgtgagtt gttaggacaa ttcaataact cctcggggct
    2701  tgtggtaaat gggggcgttt ctggtaatgt gtacaggatt aatcctagta
    2751  acccagtcgt cttcccatgg ttgcaaggga tagccgctag ttttgatcaa
    2801  tataagttcg atagggtaca gctacaatat gttcccatgt gtgccaccac
    2851  tgaaacaggc agagtagcaa tctacttcga taaggactca caagatgttg
    2901  aacctgcaga tcgggatgaa ttggcaatca tggcccattt gacagaaagt
    2951  gcaccatggt gtgagagcac ccttagtata cctgttgaca acataaagcg
    3001  gtttatgaac gacaacacca caactgaccc aaagctcgtg gatcttggac
    3051  agattgggtt agcaacatat ggaggtggaa gcacgaatcc tgttggtgat
    3101  ctctttatac actacacaat taccttgttc gaaccacaac cactagctag
    3151  cttggtagag acagagcaga ccggcactgg tgcggcacct tttggtgcca
    3201  atcttgtgac agtttctagt aacgcgacga tcaccatcta cacctttgaa
    3251  ggtcctggtg tgtatctgtt agctttgtca caacgtgcag cctcttttac
    3301  cacgtttgtt actgctggtg gtgctgttgt caattcacac acgactacta
    3351  ttacctctgg accagcgtac caatcaattt gcgaatatta ctgctgctat
    3401  acctgggggt ccataactta caatggtaca ttgtttggaa attacacact
    3451  ccaggttacc cgggccaaaa tttctaacaa cgcaactttg atatgagtga
    3501  ccatgcttgg gtgcgaaagt aggatggagg aatgatacct ggcaatgtct
    3551  gggttgacca cttagtggct taagaagtct gaccagcttt atggaaatac
    3601  aatctcttga cggaatactg ggtgaagaac ttgccataca gaacgaagtc
    3651  aagaaaatac tgttgagtca taaaactacc aaagccatac taccattagc
    3701  gcccatctca caattctcta aatggaaaat tcccaaacag gggttttatg
    3751  ccccaataga tgtcaagttt gttctcacac cacatatatc agagagagct
    3801  caggtcaggg gggtcgtcaa gcttgtcgat tcacgcgatt tgtcacccag
    3851  ccgcgagttg tatcggagca aggaattcaa tatcggtcat ggcttagtga
    3901  tcgagggttc ccaattaccc ttctgtctac cagtggggga ttatccacta
    3951  caattcgagg tcacggtgtt gcaatcacaa ttcagggaga cagcaaatct
    4001  ctactcaact tctgtcgagt ggcgtatgat gtcttccacc accccgttgt
    4051  ccagagtgag gtctgtcatg ggagcggccc agcaaccagc gatgaaatta
    4101  caaccaaatt ttaagatgtc gctggaatca tccaagggcg gtggcatgaa
    4151  gtcacatcag aagaaaaata gtaagcctaa tggccatagt aggaggggta
    4201  atctatctgg ggaagttggt ggttcttctt cctccttgcc ctcaggtgca
    4251  cagactgggg agtggataga taatgactat ggagacagct tatctgagta
    4301  ttctggtgtg tcagcatagc acaccccagg tgtcataccc tgaagtttag
    4351  taaggggggc tataaatgac gcttggtttt acctgaaatc ccttccatgc
    4401  tttgcatggt agccc