Sequence of DPV Leek white stripe virus

Leek white stripe virus genome (LWSV)

ACC No: X94560

Dated: 1997-07-16 | Length: 3662 | CRC: -1166922877

                !!NA_SEQUENCE 1.0
ID   LWRVREPLI  standard; RNA; VRL; 3662 BP.
XX
AC   X94560;
XX
SV   X94560.1
XX
DT   17-JAN-1996 (Rel. 46, Created)
DT   16-JUL-1997 (Rel. 52, Last updated, Version 18)
XX
DE   Leek white stripe virus genome (LWSV)
XX
KW   capsid protein; ORF1 gene; ORF2 gene; ORF3 gene; ORF4 gene; ORF5 gene;
KW   replicase.
XX
OS   leek white stripe virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Necrovirus.
XX
RN   [1]
RA   Lot H., Rubino L., Delecolle B., Jacquemond M., Turturo C., Russo M.;
RT   "Characterization, nucleotide sequence and genome organization of leek
RT   white stripe virus, a putative new species of the genus Necrovirus";
RL   Arch. Virol. 141:2375-2386(1996).
XX
RN   [2]
RP   1-3662
RA   Rubino L.;
RT   ;
RL   Submitted (28-DEC-1995) to the EMBL/GenBank/DDBJ databases.
RL   L. Rubino, CNR Centro Virus e Virosi delle Colture Mediterranee, Via
RL   Amendola 165/A, 70126, Bari, ITALY
XX
DR   SPTREMBL; Q83102; Q83102.
DR   SPTREMBL; Q83103; Q83103.
DR   SPTREMBL; Q83104; Q83104.
DR   SPTREMBL; Q83105; Q83105.
DR   SPTREMBL; Q83106; Q83106.
XX
CC   Related sequence:-
CC   Russo, M., Adv. Virus Res., 144, 381-428, 1994
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .3662
FT                   /db_xref="taxon:45224"
FT                   /organism="leek white stripe virus"
FT   CDS             38. .658
FT                   /db_xref="SPTREMBL:Q83102"
FT                   /gene="ORF 1"
FT                   /function="unknown"
FT                   /protein_id="CAA64247.1"
FT                   /translation="MHTPQCIARFGTTCHTHIRTARLLYVKTTYFQRFLFMFFVYSAVP
FT                   VLFVPILFIAFFHRFFKLQLGFSPEATALMHRFVDLFSRDDEPVITETSCNVDFLPGPE
FT                   SRKENLVAPKRRNHYIVKVAMAAKSQVGLLGNSRANELVYARLCREEMVKHGVRPSHIA
FT                   RMVPLAVDCHCFIPMDEDIMAAEMMRTDVMRSRRKDMGDSHAK"
FT   CDS             38. .2221
FT                   /db_xref="SPTREMBL:Q83103"
FT                   /transl_except=(pos:656. .658,aa:OTHER)
FT                   /gene="ORF 2"
FT                   /product="replicase"
FT                   /protein_id="CAA64248.1"
FT                   /translation="MHTPQCIARFGTTCHTHIRTARLLYVKTTYFQRFLFMFFVYSAVP
FT                   VLFVPILFIAFFHRFFKLQLGFSPEATALMHRFVDLFSRDDEPVITETSCNVDFLPGPE
FT                   SRKENLVAPKRRNHYIVKVAMAAKSQVGLLGNSRANELVYARLCREEMVKHGVRPSHIA
FT                   RMVPLAVDCHCFIPMDEDIMAAEMMRTDVMRSRRKDMGDSHAKXGGLLTTHGFTTPTWR
FT                   GEPAGLSVVKGPPLSKPRKLYRFTGFGANIRYGVHDHSLGNVRRGLVERVFMVEKSGKL
FT                   EYTPKPTPGAFNQLSRFTRALLPFLTKTTRLTTKEFLGFYTGRKLERYTKASESLEVIS
FT                   FQEKDSWLSTFVKAEKINITAKPDPAPRVIQPRDPRYNVELGRYLRIVKSICSRLLIAL
FT                   FGGRTIFKGINADEAGVEMKEIWDSFVDPIGIGMDASRFDQHISVEALQFEHKMWLEMF
FT                   PVSQRKHLKRLLDLQLHNRGLARCPDGTARYKVDGCRMSGDMNTSSGNCFIMCATVWNW
FT                   CTRLNLKHFRLANNGDDCMVFMERHNEESFRRGLIDYYTGLGFTMKVEETVDVLERVEF
FT                   CQTRPVLVDGSYRMIRNLHQGLSKDLHSLTDLAGVGAAQAWVSAVGEGGRVLNDGVPVL
FT                   GSFYKQFPLGSMPKSGTDMHEHINDAWKYKFGRKGSYQNLQPTPCSRFSFWLAFGILPE
FT                   EQIALEEGFSPISFQHQLEDNGEEASLLVFSRA"
FT   CDS             2181. .2483
FT                   /db_xref="SPTREMBL:Q83104"
FT                   /gene="ORF 3"
FT                   /function="unknown"
FT                   /protein_id="CAA64249.1"
FT                   /translation="MERRPLCSCFLGHENLPLSPFIACYFLFCFIIMSEPMYRSDDSSS
FT                   SKTRSKRSEGTTAQVASKSAVHKEGDFKMSLEKEGPVISMTVVGDKVEFTQNFNF"
FT   CDS             2483. .2653
FT                   /db_xref="SPTREMBL:Q83105"
FT                   /gene="ORF 4"
FT                   /function="unknown"
FT                   /protein_id="CAA64250.1"
FT                   /translation="MVIVVRESSFPLLAVWIIVIVLVAVIGALLQTPPETINQVFNEDH
FT                   HKTQYINIGKP"
FT   CDS             2650. .3405
FT                   /db_xref="SPTREMBL:Q83106"
FT                   /gene="ORF 5"
FT                   /product="capsid protein"
FT                   /protein_id="CAA64251.1"
FT                   /translation="MTTSKKSNNNNKSGKSTPKPNKNRRQSRKGQMVLQTIVEPSARGS
FT                   IYRNVIPPGIFNRDSVNLLSHTELFVGVDSGALGAFVLNGGAIIPSQMTNCNRHAVNFS
FT                   KYSWKYLEFIYIPFVATTFPGQVVLAPNFDRSDANPTSIASLEQYDYAVSTPIWGGSEG
FT                   SRRMHSNAACSAVNVIIETDNFDKVVYPYKTLANFTGLPAVDQNIFAPATMFVATQGGN
FT                   NVAIQLSVGKLYCKYVIEFFNPIDPASNM"
XX
SQ   Sequence 3662 BP; 952 A; 769 C; 874 G; 1067 T; 0 other;

X94560  Length: 3662  December 21, 2001 16:04  Type: N  Check: 3654  ..

       1  gatacctaac cagtgtctcg ttgatcagtg atcaggtatg catactcctc
      51  aatgtatcgc acgcttcggc actacatgtc acacacacat ccgcaccgca
     101  cgtctccttt atgtcaaaac cacttacttt caacgctttc tttttatgtt
     151  ttttgtttat tccgctgttc ctgtgttgtt tgtacccatt cttttcatcg
     201  ctttttttca ccggtttttc aagctgcagc tggggttttc ccccgaagct
     251  acagccctta tgcataggtt cgtggacctc ttttcacggg acgatgagcc
     301  tgtcatcaca gagacttcat gcaatgtaga tttccttcct ggaccagaaa
     351  gtaggaaaga aaatcttgta gctcctaaga gaaggaatca ctacattgta
     401  aaagtcgcta tggcagcaaa gtcccaagtg gggttactcg gcaattctag
     451  ggctaatgag cttgtatatg ccaggttgtg tagggaggag atggttaagc
     501  atggcgtaag accatcgcat attgcgcgga tggttccatt ggcggtagac
     551  tgtcactgtt ttatccccat ggatgaggat atcatggcag cggagatgat
     601  gaggacggat gttatgcgta gcagacgcaa ggacatgggg gattcccatg
     651  ccaaataggg gggcctatta accacacatg ggttcaccac tcctacatgg
     701  aggggtgaac ctgcgggtct tagtgtggtt aaaggacctc ccttatcaaa
     751  accccgtaaa ttgtatcgtt ttacagggtt tggtgccaat atacgatacg
     801  gagtgcatga tcactccttg ggtaatgtac ggaggggcct ggtagagcga
     851  gttttcatgg ttgagaaatc tggaaagctc gagtacacac caaaacccac
     901  ccctggcgca tttaatcaac tatctcggtt cactcgggca ttgttacctt
     951  tcttgaccaa gaccaccaga cttacaacca aagaatttct tgggttctat
    1001  actggtcgca agttagagag gtatacaaag gcaagtgagt cgttagaggt
    1051  gatctccttt caggagaaag atagttggtt gagtacgttt gttaaggctg
    1101  agaaaataaa tatcacagct aaacccgacc cggctccacg ggtgatacag
    1151  cctagggatc ctaggtataa tgtggagttg gggcgctatt tgcgcatagt
    1201  gaagagtatc tgttcaaggc tattgatcgc cttatttggt ggtagaacca
    1251  tatttaaagg gatcaatgct gacgaggctg gagtggagat gaaggagata
    1301  tgggactcat ttgttgatcc tattggcatc gggatggatg ccagtaggtt
    1351  cgatcaacat atcagtgttg aggctttaca gtttgaacac aagatgtggc
    1401  ttgagatgtt cccagtatcg cagaggaagc acctgaaaag gttgcttgac
    1451  cttcaactcc acaatcgagg tctagctcgt tgtcctgatg gtactgctag
    1501  gtataaggtg gatggatgtc gcatgtccgg tgacatgaat acatccagtg
    1551  gtaattgctt cattatgtgt gcaacagttt ggaactggtg cactcgtctt
    1601  aatcttaagc actttcggct cgccaacaat ggcgatgatt gcatggtgtt
    1651  catggagaga cataatgagg agtcattccg tcgaggtttg atcgattact
    1701  acactgggtt agggtttacg atgaaagttg aggagacggt agatgtcctc
    1751  gagagggtcg agttttgcca aactagacca gtactcgtgg atggtagcta
    1801  ccgcatgatc cgcaatttgc atcaaggtct ctcaaaagac ctacattccc
    1851  taacagacct agcaggtgtc ggagccgctc aagcttgggt gagtgccgtt
    1901  ggggagggtg gtagagtgct taatgatggg gtcccagttt tggggtcctt
    1951  ctataagcaa tttcctttag gtagcatgcc taagagcgga actgatatgc
    2001  acgagcatat caatgatgca tggaaatata agtttggtag gaaaggttcc
    2051  tatcaaaact tacaacctac cccctgttcc aggttctcat tttggcttgc
    2101  attcgggatt ttgcccgaag aacagattgc cttagaagag gggttttctc
    2151  ccatttcttt ccaacatcag ttggaagata atggagagga ggcctctctg
    2201  ctcgtgtttt ctagggcatg aaaacttacc actttcacca tttatcgcgt
    2251  gctattttct cttttgtttt ataatcatgt ctgagcctat gtatcgttct
    2301  gatgattctt cgtcatctaa aactaggtcc aagaggtcgg aggggaccac
    2351  agcccaagtg gccagcaaga gtgctgttca caaggagggt gactttaaaa
    2401  tgtcacttga gaaggaaggt cctgtgattt ccatgactgt tgtcggtgat
    2451  aaagttgagt ttacccaaaa ctttaatttt tgatggtgat agtcgtgaga
    2501  gaatcttcct ttcccctact tgctgtatgg ataatcgtca ttgtattagt
    2551  ggcggttatc ggcgcattac ttcaaactcc tcctgaaacc attaaccaag
    2601  ttttcaacga agatcatcac aaaactcaat atataaatat aggcaagcca
    2651  tgactactag taagaaatct aataataata ataaaagtgg caagtccaca
    2701  ccaaaaccaa ataaaaatcg taggcaatca cggaaaggac agatggtgct
    2751  gcaaaccatt gttgaaccct ccgccagagg ttctatttat agaaacgtaa
    2801  ttcccccagg catattcaat agggacagtg ttaatttact gtcgcatact
    2851  gaattgtttg ttggggttga ctctggtgca ttgggagctt ttgtccttaa
    2901  tggaggagcc atcattccca gtcaaatgac taattgtaac cgacatgctg
    2951  ttaatttctc caagtactct tggaaatatt tggaatttat atacattcct
    3001  tttgtcgcta caacatttcc tgggcaggtg gtccttgctc ctaattttga
    3051  tagatccgat gccaacccta cctcaattgc tagcctcgaa caatatgatt
    3101  atgcagtttc caccccaatt tggggtggat ctgagggcag tagacgcatg
    3151  cacagcaatg ctgcttgctc tgccgttaat gtaatcattg agactgacaa
    3201  ttttgataag gttgtttatc cgtacaagac attggccaac tttactgggt
    3251  taccagctgt tgaccagaac atctttgctc ctgcaactat gtttgttgcc
    3301  acacaaggtg gcaacaatgt cgcaatacaa ctatccgttg gtaagttgta
    3351  ctgtaagtac gtaatcgagt tcttcaatcc cattgatcct gcatccaaca
    3401  tgtagttgga ttttcttatt ttgtgtgcta ctcgcatacg tacagcgtat
    3451  gttcacctca cggttttgtt aattacattc aagtcgaagt tgcatagatc
    3501  ccgagaacgg gttttaacgg gctcctgtgg tgggagccga cgctcatcgc
    3551  ttctgaaatt tgaatggttg tcacaaaaca acatatgatg gctcactaca
    3601  acagtagtgg ggggtccagg catatgtccc gcaatactta tagctacctt
    3651  ttggtagtac cc