Sequence of DPV Brassica oleracea Melmoth virus

Brassica oleracea SLG-Sc and SLA-Sc genes and Melmoth retrotransposon sequence

ACC No: Y12321

Dated: 2002-07-08 | Length: 10477 | CRC: 211496848

                !!NA_SEQUENCE 1.0
ID   BOY12321   standard; genomic DNA; PLN; 10477 BP.
XX
AC   Y12321;
XX
SV   Y12321.1
XX
DT   01-OCT-1997 (Rel. 52, Created)
DT   08-JUL-2002 (Rel. 72, Last updated, Version 5)
XX
DE   Brassica oleracea SLG-Sc and SLA-Sc genes and Melmoth retrotransposon
DE   sequence
XX
KW   retrotransposon; SLA-Sc gene; SLG-Sc gene.
XX
OS   Brassica oleracea
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliophyta; eudicotyledons; core eudicots; rosids;
OC   eurosids II; Brassicales; Brassicaceae; Brassica.
XX
RN   [1]
RA   Pastuglia M., Ruffio V., Delorme V., Dumas C., Cock J.M.;
RT   ;
RL   Unpublished.
XX
RN   [2]
RP   1-10477
RA   Cock M.J.;
RT   ;
RL   Submitted (05-APR-1997) to the EMBL/GenBank/DDBJ databases.
RL   M.J. Cock, Ecole Normale Supereure de Lyon, Reconnaissance Cellulaire e,
RL   Amelioration des Plantes, 46 Allee d'Italie, 69364 Lyon Cedex 07, FRANCE
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .10477
FT                   /db_xref="taxon:3712"
FT                   /mol_type="genomic DNA"
FT                   /organism="Brassica oleracea"
FT                   /variety="acephala"
FT                   /strain="p57Sc"
FT   CDS             join(<110. .1418,2252. .2427)
FT                   /db_xref="GOA:O23740"
FT                   /db_xref="InterPro:IPR000858"
FT                   /db_xref="InterPro:IPR001480"
FT                   /db_xref="InterPro:IPR003609"
FT                   /db_xref="UniProt/TrEMBL:O23740"
FT                   /gene="SLG-Sc"
FT                   /protein_id="CAA72988.1"
FT                   /translation="MKGLQNIYHHSYTFSFLLVFLVLILFHPALSIYVNTLSSSESLTI
FT                   SSNRTLVSHGGVFELGFFKPLGRSRWYLGIWYKKVSQKTYAWVANRDSPLSNSIGTLKI
FT                   SGNNLVLLGQSNNTVWSTNLTRENVRSPVIAELLPNGNFVMRYSSNKDSSGFLWQSFDF
FT                   PTDTLLPDMKLGYDLKTGRNRILTSWRSSDDPSSGNTTYKIDTQRGLPEFILNQGRYEM
FT                   QRSGPWNGMEFSGIPEVQGLNYMVYNYTENSEEISYTFHMTNQSIYSRLTVSDYTLNRL
FT                   TWIPPSRAWSMFWTLPTDVCDPLYLCGSYSYCDLITSPNCNCIRGFVPKNPQQWDLRDG
FT                   TQGCVRTTQMSCSGDGFLRLNNMNLPDTKTATVDRIIDVKKCEERCLSDCNCTSFAIAD
FT                   VRNGGLGCVFWTGELVEIRKFAVGGQDLYVRLNAADLDFSSDEKRHRTGKIIGWSIGVS
FT                   VMLILSVLVLCFWKRRQKQAKAYVVGMKNFVEMEKV"
FT   exon            <110. .1418
FT                   /number=1
FT   intron          1419. .2251
FT                   /number=1
FT   exon            2252. .>2427
FT                   /number=2
FT   misc_feature    3040. .3531
FT                   /note="SLA-Sc allele, corresponding to transcribed region
FT                   of SAL-S2"
FT   repeat_region   3532. .8357
FT                   /transposon="Melmoth"
FT   LTR             3532. .3732
FT                   /note="5'-LTR"
FT   misc_feature    3737. .3748
FT                   /note="RNA priming site"
FT   CDS             3935. .7330
FT                   /db_xref="GOA:O23741"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR005162"
FT                   /db_xref="UniProt/TrEMBL:O23741"
FT                   /note="open reading frame 1"
FT                   /protein_id="CAA72989.1"
FT                   /translation="MVIPPESMDPNQSPLFMHNADHPGLQLISLKLDGSNYDDWNAAMK
FT                   IALDAKNKIGFVDGTLTRPDTSDPTFRLWSRCNSMVKSWLLNSVSPQIYRSILRLNDAA
FT                   DIWRDLHGRFHMTNLPRTFNLTQEIQDLKQGSMSLSDYYTTLKTLWDNLESVDEPDTPC
FT                   VCGNAEKLQKKVDRAKIVKFLAGLNDSYAIIRRQIIMKKVLPSLVEVYNILDQDDSQKG
FT                   FSTAITPAAFNVSENVPPPMAEAGICYVQTGPNKGRPICSFCNRVGHIAERCYKKHGFP
FT                   PGFVSKYKSQSSGDRLQKPKQVAAQVSFSPPNSGQSPMTMDHLVGNHSKEQLQQFIALF
FT                   SSQLPNVTMGSNEASSSKQPMDNSGISFNPTTLVFIGLLTVSRHTLANETWIIDSGATH
FT                   HVCHDRSMYTSIDITTTSNVNLPNGMIVKISGVGIVQLNEHITLHNVLYIPEFRLNLLS
FT                   ISSLTSDIGSQVIFDVSSCAIQDPTKGWTIGQGRRVANLYVLDVKSSPMKINAVVDISL
FT                   WHKRLGHPSYTRLDKISEALGTTKHKNKGDAHCHVCHLAKQKKLSYSSQNHICTASFQL
FT                   LHVDVWGPFSVETLEGYKYFLTIVDDHSRATWIYLLQSKSDVLHIFPTFVNQIETQYNT
FT                   KIKSVRRDNAPELSFTELFKEKGIVSYHSCPETLEQNSVLERKHQHLLNVARALMFQSQ
FT                   VPLQYWGDCVLTAAFLINRTPSPLLANKSPYEVLMGKAPQYDQLRTFGCLCYGSTSPKQ
FT                   RHKFMPRSRACVFLGYPSGYKGYKLLDLESNKIYISRNVTFHEDIFPMAKHQKMDESSL
FT                   HFFPPKVTVPSAPSPNISSSPFSTLSPQISKRQRTVPAHLKDFHCYSVHDSAYPISSTL
FT                   SYSQISSHHLAYINSITNIPIPQSYAEVRQSKEWTESADKELDAMEENDTWDVVPLPKG
FT                   KKAIGCRWVHTLKFNADGTLERRKSRLVGKGYTQKEGLDYIETFSPVAKMATVKLLLKV
FT                   GASKKWFLHQLDISNAFLNGELDEEIYMKLPEGYAERKGDLPPNAVCKLKKSIYGLKQA
FT                   SRQWFKKFSTSLFQLGFQKAHGDHTLFVRQTENDFVAVLVYVDDIVIASTDDAVAVKLK
FT                   SDLKSFFKLRDLGSLKYFFGFGNL"
FT   CDS             7395. .8156
FT                   /db_xref="UniProt/TrEMBL:O23742"
FT                   /note="open reading frame 2"
FT                   /protein_id="CAA72990.1"
FT                   /translation="MLDCKPSSVPMMPNLKLSKVDGDLIEDREMYRRLVGRLMYLTITR
FT                   PDITFAVNKLCQFSSAPRTSHLGAVYKVLQYIKGTVGQGLFYSAHSDLTLKGFADADWA
FT                   ACVDSRRSTTGFTMFVGDSLISWRSKKQPTVSRSSAEAEYRALALASCEMMWLCILLRE
FT                   LHVASSSVPVLFSDSTAAIYIATNPVFHERTKHIELDCHTVREKIDKGLLKTLHVRTED
FT                   QVADILTKPLFPYQFEHLKSKMCIRNIFCTS"
FT   misc_feature    4715. .4756
FT                   /note="RNA binding site"
FT   misc_feature    5105. .5140
FT                   /note="protease domain"
FT   misc_feature    5474. .6315
FT                   /note="endonucease domain"
FT   misc_feature    6698. .7315
FT                   /note="reverse transcriptase domain"
FT   misc_feature    7395. .8156
FT                   /note="RNAseH"
FT   LTR             8164. .8357
FT                   /note="3'-LTR"
FT   misc_feature    8358. .9977
FT                   /note="SLA-Sc allele, corresponding to transcribed region
FT                   of SAL-S2"
XX
SQ   Sequence 10477 BP; 3152 A; 2021 C; 2059 G; 3245 T; 0 other;

   Y12321  Length: 10477  May 9, 2005 17:26  Type: N  Check: 9515  ..

       1  tttaatttcg aatttcttcg aagtaactta gatgatatat atatagtatg
      51  caagttagga caaaaactaa caacaagaaa aaaagaaaga aagaaagtgg
     101  tggggagaga tgaaagggct acagaacatt taccaccatt cttacacctt
     151  ctcgttcttg ctagtcttcc ttgtcttgat tctatttcat cctgcccttt
     201  cgatctatgt caacactttg tcgtcttcag agtctctcac aatctcgagc
     251  aatagaacac ttgtatctca cggtggagtc ttcgagcttg gtttcttcaa
     301  acccttggga cggtcgcgtt ggtatctcgg aatatggtat aagaaagtct
     351  cccagaaaac ctacgcatgg gtcgccaaca gagacagccc tctctccaat
     401  tccattggaa ccctcaaaat ctctggcaac aatcttgtcc tgctaggtca
     451  gtctaataac actgtttggt cgacaaatct tactagagaa aatgtgagat
     501  caccagtgat agcagagctt cttcccaacg gtaattttgt aatgagatac
     551  tccagcaaca aagactcaag tggattcttg tggcagagtt tcgattttcc
     601  gacagatact ttacttccgg atatgaaact aggttacgat ctcaaaacag
     651  ggcgtaacag aattcttaca tcatggagaa gttcagatga tccgtcaagc
     701  gggaatacca cgtacaaaat cgacactcaa aggggattgc cagagtttat
     751  tcttaatcaa ggacgttatg aaatgcaaag gagcggtccg tggaatggaa
     801  tggagtttag tggcataccg gaggtgcaag gattaaatta catggtttac
     851  aattatacgg agaacagtga ggagatctct tacacgttcc atatgaccaa
     901  ccaaagcatc tactccagat tgacagtcag tgactataca cttaatcgat
     951  tgacgtggat cccgccatca cgggcatgga gcatgttctg gactttaccg
    1001  acggacgtgt gcgatccact ttacttatgt ggatcttatt cttactgtga
    1051  cctaattacg tcacctaact gtaactgtat tagagggttc gttcccaaga
    1101  acccgcagca gtgggacttg agagacggaa cacaggggtg tgtgaggacg
    1151  acgcagatga gctgtagtgg agatggcttt ttgcggctaa acaatatgaa
    1201  tttgccggat accaagacgg cgactgtgga tcggataatt gatgtgaaaa
    1251  aatgcgaaga gaggtgtcta agtgattgta actgtacgtc gtttgctatt
    1301  gcggatgttc gaaacggcgg attgggttgt gtgttttgga ccggagagct
    1351  cgttgagatc aggaaatttg ccgtcggtgg tcaagatctt tacgtcaggt
    1401  tgaatgctgc tgatctaggt tagtgtaatc ttctaaaact aaacacatcg
    1451  gatatctatc tcatcaattc aaataataaa tgtgacccgt tcatccaaat
    1501  aagtaaataa acaaaaagca aaaacagtta atagaataaa atagtataat
    1551  tggacagtta cataggaaca tattgatagc taattataat cccattgata
    1601  gtgtatgcat ctacatgtta gagtttcata atgatgttga caaaaaaaca
    1651  ttgtggatac aaaaaaaata gtggatacaa aattataaaa tgcataataa
    1701  atgatatata ttttctgatc aaatcaatat atgatattat aagatgcaaa
    1751  atagtaagtt atcagcccgt accttgcatg gacaatatat agtagatata
    1801  aaatcgtaaa taaataaatt taaatatatt ttttctgttg gacaactaaa
    1851  taaaattatt taaacacgaa ttatacatgc aacgggccgg ctaatattag
    1901  tatttatgat tactaattct gtagaagcag gacgataaaa tagatgaata
    1951  taattcggca aatacaaggg atgtatacgt gaactcgacc aaatattttt
    2001  ttaaaaaaaa actcgaccaa atattttaaa aaactataac tcataatttc
    2051  tgtcatgtca gcgtcaggcg tcattaacta cataagacat tagttttttg
    2101  tttttgttcc tcgtcctcga tctcatacta atttcttaac ctgtcgaagt
    2151  caattttttt ttgttttatg cgctgcaaaa gccattcatg ccaaaaggtt
    2201  tgagttggtc agcttaatag cctgtcaaat ttgtgacacg actctgtgca
    2251  gatttttcct cggatgagaa gagacaccga actggaaaaa tcataggttg
    2301  gagtattgga gtcagcgtta tgcttattct gagtgttctc gtgttatgct
    2351  tttggaagag gagacagaag caagcaaaag catatgttgt tggaatgaaa
    2401  aactttgtag agatggaaaa agtgtgaaaa agtgttttaa gtacttgaaa
    2451  aaaaagaaat tttgcgaaga aaaacaactt tttattattt aagaggattt
    2501  gttattacta gaatgataca aaatgaaaag agaatgaatg tatttagaac
    2551  ctccaaagta caaaatattt taaatatttt aatctaaaat ctaaaaaaat
    2601  ctacttaatt aaacatctag ataattttat gaaaatatat agatttttat
    2651  tttaaagaga tggaagactt ctttagaact tatgttaaat atggaccaac
    2701  acatgatttg tgaattgtta tcccaataat ataacccaaa tcgttgccaa
    2751  aaaaaaaaaa atatatatat atatatatat aacccaaatc aagttttctt
    2801  ttcaacaccc ttccctaaac ttgatttgct tattctgagt aacctcagca
    2851  ttttgatatt gtctttccgt ttgagtggct tagtgaagat attagctact
    2901  tgataatttg tcttcacata ctccaattgc acgttcatat tggtaaccca
    2951  ttttctaata taatgataac gaatatttat gtgcttactc caatgatgaa
    3001  agactggatt tcaccaatgc tattgttgat ttgttatctg ttggaggatg
    3051  gaccttcagc ctgttcgcga gttgaacata tttgaataag gcccagtacg
    3101  gggaagccga cccgtttgga atgataaccc tcgctcttca cgcaaacaag
    3151  gacaacgagg aacagtggcc tagaccgtag gctgcactct tcgccgatca
    3201  tagccaaaca cgaaccgatt ctctgacaca accaccgcta gacggaagga
    3251  gaaagggaaa taggtcttta tatacaggag agaattcaat gagaaagggg
    3301  gatccagaac gagagagaga gagagagaga gctattgaca acgagttcac
    3351  tttcttttgt atctttctgt tcggcaaaca gcttaacact tcaataaaca
    3401  agatctttgg cccctaaact ctatttatta ttgtataaga tccttaaact
    3451  tggttacagg ttttaggatt caacaatatt ggcccccaca gtggagcctt
    3501  aaggattcct acgcacaaag ttcgcaagcg ctatcagagt ttaaattata
    3551  ttggttaaat tcggtttcct tttgccggtt taccttaagt ttggtttagt
    3601  atagattgta tataaagtga acgttgtaca ttgattttaa actaatgaga
    3651  aatatctttt aatctgtaac aaactttctc atctcttctc tcttgattct
    3701  ctctcgattc tctctcagtc ctgattcgta atatggtatc agagccatct
    3751  gagctcgttt attcgtgatt cttccgttga ttcgtgtttt tctcaagctc
    3801  acgatggtat cggtgaagaa gattccgcga aaatcgactc gcgtaactcg
    3851  caaaccgatc cggtccaccg atgtcgatga ttcacctccg ccttctctcc
    3901  ggtagctcaa cctcgcaaca ccggagctcc gcgaatggtg atacctcctg
    3951  aatcgatgga tccgaatcaa tctcctctat ttatgcataa tgccgatcat
    4001  ccaggtttac agctgatttc tcttaaactg gatggatcga attatgatga
    4051  ttggaatgca gctatgaaga ttgctctaga tgcgaaaaat aagataggat
    4101  ttgtagatgg aactctcact cgtcctgata catccgatcc tacttttcgc
    4151  ttatggtcta gatgcaatag tatggtgaaa tcatggttgt tgaactcagt
    4201  ttctcctcag atctatcgca gtattttgcg cttgaatgat gctgcagata
    4251  tttggcgtga tcttcatggt cgctttcata tgacgaacct ccctcggacg
    4301  tttaacttga ctcaagagat tcaagatctc aagcaaggat ccatgtctct
    4351  ctcggattac tacactactc taaagacact ttgggataat ttggagagtg
    4401  tagatgaacc agatacacct tgtgtttgtg ggaatgcaga aaaattgcag
    4451  aaaaaggtag atagagcaaa gattgttaag tttcttgctg gcttaaatga
    4501  ctcttatgca atcattcgaa gacagatcat tatgaagaaa gttttgccct
    4551  ctctggttga agtatacaac attcttgatc aagatgatag tcagaaaggc
    4601  ttctcaacgg ctatcactcc ggcagctttc aatgtttctg agaatgtgcc
    4651  tcctccaatg gctgaagcag ggatttgtta tgttcaaact ggtcctaata
    4701  aaggaagacc tatctgttct ttctgcaacc gtgtgggtca tattgctgaa
    4751  agatgctata aaaagcatgg atttccaccg gggtttgttt ccaaatacaa
    4801  gtctcagtca tcaggagata gacttcagaa gcctaaacaa gtggcagctc
    4851  aagtatcttt cagtcctccg aactcaggac agtcaccgat gactatggat
    4901  catctggttg gcaatcacag caaagaacaa cttcaacagt tcattgctct
    4951  cttcagttct cagttaccaa atgtcaccat gggttcaaat gaagcaagtt
    5001  cttctaaaca gcctatggat aactctggta tatcttttaa tccaactact
    5051  cttgttttca ttggtttatt gactgtctct agacatactt tggccaatga
    5101  aacatggata atagattctg gggctactca tcatgtttgt catgatcgca
    5151  gtatgtatac ttctattgac atcactacaa ctagtaatgt gaatttgcca
    5201  aatgggatga tagtcaagat cagtggagtt ggaattgttc aactaaatga
    5251  gcatattact ctccacaacg tcttgtatat accagaattt cggctcaacc
    5301  tcctcagtat cagttctctg acaagtgata ttggttctca ggttatcttt
    5351  gatgtttctt cttgtgcaat tcaggatcct accaagggtt ggacgattgg
    5401  acagggtaga cgtgttgcta atctctatgt gcttgatgtt aagagttcac
    5451  cgatgaagat caatgcagtg gtggatatta gtctatggca caagaggttg
    5501  ggacatcctt cctacacaag actggataaa atttccgaag ctctaggaac
    5551  tacgaaacac aagaataaag gcgatgctca ctgtcatgtg tgtcatcttg
    5601  caaagcagaa gaagttgtct tattcttctc agaatcatat ttgtactgcg
    5651  agttttcaat tacttcatgt tgacgtttgg ggaccatttt ctgtggaaac
    5701  tttggaaggt tataagtatt ttctcaccat tgttgatgat cactctcgag
    5751  caacatggat ctacttatta caatccaaaa gtgatgttct tcacatcttc
    5801  cctacctttg tcaatcaaat tgaaacacag tacaacacaa agatcaaatc
    5851  agtgagaaga gataatgcac cggagctaag tttcacagag ttattcaagg
    5901  agaagggtat tgtttcttat cattcttgtc ctgagacact agagcagaat
    5951  tctgttttag agaggaaaca tcaacactta ttgaatgttg ctcgtgcatt
    6001  gatgtttcag tctcaagttc ctttacaata ttggggagat tgtgtgctca
    6051  ctgctgcttt tctcatcaac agaactccat ctcctttgct tgctaataag
    6101  tcaccttatg aagtacttat gggtaaagct cctcagtatg atcagcttcg
    6151  aacatttggg tgtttgtgtt atggttccac atctccaaaa caacgtcaca
    6201  agttcatgcc tcggtctcgt gcttgtgtgt ttttgggcta cccttctggc
    6251  tataaggggt acaaacttct ggatttggag agcaacaaga tatatatatc
    6301  tcggaatgtt acttttcatg aagatatctt tcctatggct aaacatcaga
    6351  agatggatga atcatcactt catttctttc ctccaaaagt taccgtacca
    6401  tcagctccat caccaaatat ttcttcttct cctttttcaa ccttatcacc
    6451  acaaatttct aaaagacaga gaacagttcc tgctcatcta aaggactttc
    6501  attgttactc tgttcatgac tctgcttatc ccatatcttc tactctttca
    6551  tactctcaaa tttcttcaca tcatcttgct tacattaata gcattacaaa
    6601  tatccctatt ccacaatcat atgctgaggt acggcaatct aaagaatgga
    6651  ctgagtctgc agataaagag ttggatgcaa tggaggagaa tgatacatgg
    6701  gatgttgttc cattgcctaa agggaagaaa gctattggat gtcgttgggt
    6751  acatacgttg aagtttaatg cggatggcac gttggaaaga agaaaatctc
    6801  ggttggttgg taaaggttat actcaaaagg agggattgga ttatattgag
    6851  acattttctc cagtggcaaa gatggctacg gtgaaattgt tgttgaaagt
    6901  tggagcttca aagaaatggt ttcttcatca gttagatata tcaaatgctt
    6951  tccttaatgg tgaactggat gaagaaatct atatgaagct tcctgagggt
    7001  tatgcagaga gaaaggggga cttgccacct aatgctgttt gtaagttgaa
    7051  gaagtccatc tatggtctca aacaagcatc tagacagtgg tttaagaaat
    7101  tttcaacctc gttgtttcag cttgggtttc agaaagctca tggtgatcat
    7151  actctttttg tgagacaaac tgagaatgat tttgttgcgg tattggtgta
    7201  tgtagatgat atcgtaattg ctagtactga tgatgctgtt gcagtgaaac
    7251  tcaagtctga tcttaagagc ttctttaagc tacgtgatct tggaagcctt
    7301  aagtattttt ttgggtttgg aaatctctag gacatctgat ggtatttctc
    7351  tatgtcaacg caagtatgcc ttggaacttc tcacttctac aggcatgcta
    7401  gactgtaaac catccagtgt tcctatgatg ccaaacttga agttgtctaa
    7451  agtggatgga gatttaattg aagatcggga gatgtacaga cgtcttgttg
    7501  gtcgtttgat gtacttgaca attacaagac ctgacatcac attcgcagta
    7551  aataaactct gtcagttctc ttccgctcca agaacatctc atcttggtgc
    7601  agtatataag gtgttacaat acatcaaggg tactgtagga cagggtttgt
    7651  tctactctgc tcattctgat ttgactttga aaggctttgc ggatgctgat
    7701  tgggcggctt gtgttgatag tcgccgctcc actactggtt tcacgatgtt
    7751  tgtaggtgat tcattaattt cttggcgctc taagaaacag cccacggttt
    7801  ctagatcatc agctgaagct gaatatagag ctttggcgct tgcatcttgt
    7851  gaaatgatgt ggctgtgtat tcttcttcgt gaactgcatg ttgcttcttc
    7901  atcagttcca gttctctttt ccgatagtac tgcagccatt tatattgcga
    7951  caaacccggt ctttcacgaa cggactaagc atattgagct tgattgtcat
    8001  accgtgcgtg agaagattga taaaggtttg cttaagactc ttcatgtgag
    8051  aacagaggat caggttgcag atatccttac taaaccatta ttcccttatc
    8101  aatttgaaca tctgaaatcc aagatgtgca tacgcaacat cttctgcaca
    8151  tcttgagggg gactatcaga gtttaaatta tattggttaa attcggtttc
    8201  cttttgccgg tttaccttaa gtttggttta gtatagattg tatataaagt
    8251  gaacgttgta cattgatttt aaactaatga gaaatatctt ttaatctgta
    8301  acaaactttc tcatctcttc tctcactctc gattctctct cagtcctgat
    8351  tcgtaataag cgcccgcaaa gcaggaaaaa tgtctacatc atccaccgga
    8401  caacccacga ctaaagcaag tgaccgacaa accctagcac cgcgacaaag
    8451  tggggtggag tcaggaaaga gcagccagat taaccccgga aatatgcgcc
    8501  acccatcctc gtccgccatc gacgccttgc tctcaaacgc caggaccgct
    8551  tctaccacga caccatctac ggcacagacg aaccaccctc atgaaatcat
    8601  gaccagcccg gcgcaacccc tgatcacccg atggaactgc cgaacccaac
    8651  ccacacgcgg ctaaaaaaga tccccaaata ctgacgttac ggccgtacta
    8701  cacacactag tcgaaaaagt agatgaactc acttgccgag gaacgcaaga
    8751  accagcgacc taaacctaga tgccgactcc acataactgc tggaggagga
    8801  gcagacgacc cgaaatgttg ggcgcatacc catcgagttg accgcttaga
    8851  ttcagcgaaa cctttttgga gactcggaaa caccgaccca aaggaaaacg
    8901  gcacctccaa ctcactttta gacaattgta cgtcccatca actttttatg
    8951  gatatccttg aactatgctc ctaattgatt tgcttggctt gcattaattt
    9001  ccaagagctg gttgagaaga agatcagtac taatctcctt tggttgaggg
    9051  tttgaagaac ttccttttct ttggtttggt gtattgtctt tgtaaggaca
    9101  gaaactgggt ggatagttgt tgagtttggg ttgatagcct ccttgttggt
    9151  tgttgtaaga tggcttttgt tggtagtctc cttggtactg aggttttctt
    9201  aaaaagattc cttatagagt gttctgctca tttggtttga aaggtggata
    9251  gttttgatct ttttgtctac attgtgctta tgtttgagag gttatagttg
    9301  tagtagttgt tatagttgtt gttgatgtag ccttacctac tgacatagtt
    9351  aacatcttct tgaccctctt gctcatgatt ctgtcttgct catgattctg
    9401  ttgagattca ttgtagcctt gctattgatc aaattcaccc attaaattta
    9451  catttttctg ccttttcaaa aaggatgtcg atttggtcat gtactgcttt
    9501  cgctcccttc ttgtgtgctc atcttgagct ccacctctat tgttggttct
    9551  gtcataatca tcacaataga tagtcacttt gagcaagatt ctctaccaac
    9601  tgcatcccct tgtttgaaat catcccaaga gatgcccact gcttacagtg
    9651  tcaagcatgt tcttaaattt gggcaagact cctctgtaga agggtctcaa
    9701  caaagtctcc tttctgaatt catggtgagg gccctgcata atctagccct
    9751  tgatgaaccg ctccatcctt caccaaagtt ctctattctt ttatattata
    9801  actcaatact tttactcctc aaagacattt cacctttcat tgacaaatat
    9851  agataaagaa agtaagttag taaccaaata gaaaataaga tttagtctca
    9901  agcaatgact gaattccaat gtcaaaatca atcttaggat ttgcaacggt
    9951  atcaaaactc aataagaaat cagtttatta atcttgtata actctagtta
   10001  caagctctaa tgttgttgta atataagagt tgtcaatcag aacctaatat
   10051  gactctaagc aaagagaatg aaaataatta ccaaatataa ttaagcaata
   10101  taagttttgt gaataagtaa ttaaacataa actaaacaag attcaaactt
   10151  aatgatctga aactcaaaca aacttaagaa caataacaac cttttaatca
   10201  aaggttaagg tatggatcca tgggcaagac tttcatttaa gataattaat
   10251  attcaaccaa aggggctcaa actaacaatc attcaagtta catacgtcta
   10301  gacacaaatg tttcagcaaa cttatttcgg acatgaaatg tttggatcta
   10351  gatatagaga gatcaagact aattcagtat taggatcact aaagaagcat
   10401  agaacaagat atgaaggatc tagcaatata cacccaagtc ttcactaaat
   10451  catcctaatc tacgtaacca tagatcc