Sequence of DPV Citrus tristeza virus

Citrus tristeza virus defective RNA, strain T411

ACC No: Y18368

Dated: 2006-11-14 | Length: 2759 | CRC: 934747199

                
ID   Y18368; SV 1; linear; genomic RNA; STD; VRL; 2759 BP.
XX
AC   Y18368;
XX
DT   11-DEC-1998 (Rel. 58, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 4)
XX
DE   Citrus tristeza virus defective RNA, strain T411
XX
KW   defective variant.
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RX   PUBMED; 10092024.
RA   Ayllon M.A., Lopez C., Navas-Castillo J., Mawassi M., Dawson W.O.,
RA   Guerri J., Flores R., Moreno P.;
RT   "New defective RNAs from citrus tristeza virus: evidence for a
RT   replicase-driven template switching mechanism in their generation.";
RL   J. Gen. Virol. 80:817-821(1999).
XX
RN   [2]
RP   1-2759
RA   Moreno P.;
RT   ;
RL   Submitted (05-NOV-1998) to the EMBL/GenBank/DDBJ databases.
RL   P. Moreno, Instituto Valenciano de Investigaciones Agrarias, Apartado
RL   Oficial 46113 Moncada, Valencia, SPAIN
XX
CC   Related sequence Y16842
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .2759
FT                   /organism="Citrus tristeza virus"
FT                   /specific_host="citrus"
FT                   /strain="T411 from Spain"
FT                   /mol_type="genomic RNA"
FT                   /note=" CTV(T411) D-RNA 2.7 kb"
FT                   /db_xref="taxon:12162"
FT   5'UTR           <1. .108
FT   CDS             109. .183
FT                   /note="ORF"
FT                   /db_xref="UniProtKB/TrEMBL:Q9WIE1"
FT                   /protein_id="CAA77146.1"
FT                   /translation="MSKLGASFKSLTFAVRSDYIISRI"
FT   misc_feature    1625. .1628
FT                   /note="junction site"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   misc_feature    1817
FT                   /note="sgRNA ORF11"
FT   CDS             1856. .2485
FT                   /note="ORF11"
FT                   /db_xref="InterPro:IPR006893"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YJI6"
FT                   /protein_id="CAA77147.1"
FT                   /translation="MDDTSGQTFVSVNLSDESNTASTKVENVKSEADRLEFLRKMNPFI
FT                   VDALVRKTNYQGARFRARIIGVCVDCGRKHDKALKTERKCKVNNTQSQNEVAHMLMHDP
FT                   VKYLNKRKARAFSNAEMFAIELVLYTKERQLAVDLAAEREKTRLARRHPIRSPEETPEH
FT                   YKFGMTAKAMLPDINAVDVGDNEETSSEYPVSLSVSGGVLREHHFI"
FT   variation       183
FT                   /replace="g"
FT                   /note="in full length T411"
FT   variation       188. .190
FT                   /replace="cc"
FT                   /note="in full length T411"
FT   variation       735
FT                   /replace="t"
FT                   /note="in full length T411"
FT   variation       1114
FT                   /replace="c"
FT                   /note="in full length T411"
FT   variation       1467
FT                   /replace="c"
FT                   /note="in full length T411"
XX
SQ   Sequence 2759 BP; 605 A; 668 C; 718 G; 768 T; 0 other;

y18368 Length: 2759  14-NOV-2006  Type: N  Check: 4085  ..

       1  aatttcgatt caaattcacc cgtacctccg gagctcgatc cggaccctgc
      51  gggacttggt gtaaatccca accagacggt tgctctacgc ccataatatc
     101  aatacaacat gtcgaaactc ggagctagct tcaagtcctt gactttcgct
     151  gtacgcagcg attacataat ttcgcgcatc tgacgcgccc tttaataccg
     201  ttggagtcct gcacttcttc ggcactgata caaccactac ggtggttaag
     251  gagttttcgg ctgctgggcc gatcgtccct ttacggaaat cctgttttcc
     301  gttctctgtt cgcgctgctg ttcgcgcgat taaagctgcc ggacgtccta
     351  ttgacgctcc gcgctccgga tgcctctgtg gcctccctgt tttcgacaca
     401  tctggtgtcg tgcgtccccg ctctgttgcg ggcgcttgga ggtatgctct
     451  gtgtaaacct ccccttactg ctgccgccaa gaagtccatt cgcaaggcga
     501  agaaagattc tgcattcttt ctcagccggg cttcttctct cttctctcgg
     551  gaagtcccct gcggcacgcg tcacagactt cgcaggcgtg ttgcgaaact
     601  agttgaccct actgtgcgtg aaagtcccca agacaagact aaacttaagg
     651  ggcgccgata tggcaaaaat tctgacctcc cgtatatggg ggaagcggcg
     701  ttggatgaca tccttcgctg gattgagggg gtaaatcctc cgccgtcgat
     751  ggtcgccgtt ccggtgccca tctcttttgg cactctgccc actacggctt
     801  ggtgctctga ggccgacgcc gctgttctgc ggtgtcgctt agactatcac
     851  gccgctgcga cttcctttcg taatgaaggg aagcacgtga gatacgtcta
     901  taatgacgtg tcttccgctg ccaaccgtcc tcgtacggtt tctccccgca
     951  agtgcgggcg tatttttccc agcggttctg cgctgggtgt tgaggttcca
    1001  agtactaggg accgccacac cgctttcgtg agatctactc acgctagcgt
    1051  tttcttttct gacgcggttc gccgcgttcg aatgttccgt cctgggcgga
    1101  ataatttctt tactagcgtc gtcagtgggc ggcgcgttag ttactttaga
    1151  cccggaccta acggtacggt gtctgttcta atgtcggatg gcgtcaatac
    1201  ggcgcgtctc gacgttgtcg ctcccgcgta ctatgcgtac gcaaaaacgt
    1251  tgggcgccag agtgcgctgt ttgtgggagt cgtccgattt ggacgatgct
    1301  aaaatacgtg acggtcaatg ctacattcgt cacgtgtacg acgtggccct
    1351  atattttggg aggcgcgtcg acctttctgt gcgccgcact ttgggtttat
    1401  tccccacagt gggtgcgtta aaggcttatc ttgttcgcga gtatggtcgc
    1451  gactctttga aggttcagat gcgcgggact tacacttttg gcagtgtatt
    1501  tcattgcctg tcgactaaat cttctgtcga cttaagatct gttcctaacc
    1551  atcacttggt tggtggtgag tctgctcact tgtttgttgg gcagattcgt
    1601  cttgatgtcc gtggtggcgt ctctaagctg tgctgtcgga attgtcccgc
    1651  acgcataaac tagattttag cgagcgagcc tttacggctt acggtatcct
    1701  tttgcagaag ggcaccgtgg caaccgtttg cggtcagttt gacattaatt
    1751  tagtttctcc gtcttgcgtg taggttaata cgcttctcag aacgtatggt
    1801  tgtattaact aactttaatt cgaacatatt tattgtttaa agtctgtgag
    1851  ttacgatgga tgatactagc ggacaaactt tcgtttctgt gaacctttct
    1901  gacgaaagca acacggcaag cactaaagtt gaaaacgtaa aatcggaagc
    1951  ggatcgcttg gaatttttac gtaaaatgaa tccctttatt gttgacgctc
    2001  tggtgcggaa aaccaattat cagggtgctc gctttcgcgc aagaataata
    2051  ggagtgtgcg tggattgtgg tagaaaacac gacaaggcgc tcaagactga
    2101  acgtaagtgt aaggtcaaca atacgcaatc tcagaacgag gtggcgcata
    2151  tgttgatgca cgatcccgtt aagtatttga acaaaagaaa ggctagagcc
    2201  ttttctaacg cagagatgtt tgcgattgaa ttggttttgt acaccaagga
    2251  aaggcaattg gcggtcgatt tagccgctga aagggagaag acgagactgg
    2301  ctcgtagaca cccaatacgt tctccggaag aaactccgga acattataaa
    2351  ttcggtatga ctgctaaggc aatgttaccg gacatcaacg ccgtagacgt
    2401  tggtgataac gaggaaactt cgtcggagta cccagtgagt ctgagtgttt
    2451  ctggcggagt tctccgtgaa caccacttca tctgattgaa gtggacggaa
    2501  taagttcctt gcggaacttt aagtcgggtt ggtaaaaacc ctttatgatg
    2551  gtgatgtatc actagacaat aaccggatgg gtaaagtctt taaaatgatc
    2601  gaggggaaaa ttaaccgtat cctctcgttg gtctaagctc ccacagagtg
    2651  gtagtggtct caagtgaggc ttaacgtatg cgtgaaccaa agaagttctc
    2701  cttagagtgt gtgttgttta cccaacacac tgtccctatg gggggccaac
    2751  ataggtcca