Sequence of DPV Citrus tristeza virus

Citrus tristeza virus defective RNA, strain T317

ACC No: Y18369

Dated: 2006-11-14 | Length: 1970 | CRC: 864023902

                
ID   Y18369; SV 1; linear; genomic RNA; STD; VRL; 1970 BP.
XX
AC   Y18369;
XX
DT   11-DEC-1998 (Rel. 58, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 4)
XX
DE   Citrus tristeza virus defective RNA, strain T317
XX
KW   defective variant.
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RX   PUBMED; 10092024.
RA   Ayllon M.A., Lopez C., Navas-Castillo J., Mawassi M., Dawson W.O.,
RA   Guerri J., Flores R., Moreno P.;
RT   "New defective RNAs from citrus tristeza virus: evidence for a
RT   replicase-driven template switching mechanism in their generation.";
RL   J. Gen. Virol. 80:817-821(1999).
XX
RN   [2]
RP   1-1970
RA   Moreno P.;
RT   ;
RL   Submitted (05-NOV-1998) to the EMBL/GenBank/DDBJ databases.
RL   P. Moreno, Instituto Valenciano de Investigaciones Agrarias, Apartado
RL   Oficial 46113 Moncada, Valencia, SPAIN
XX
CC   Related sequence Y16841
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1970
FT                   /organism="Citrus tristeza virus"
FT                   /specific_host="citrus"
FT                   /strain="T317 from Spain"
FT                   /mol_type="genomic RNA"
FT                   /note="CTV(T317) D-RNA 1.9 kb"
FT                   /db_xref="taxon:12162"
FT   5'UTR           <1. .108
FT   CDS             109. .333
FT                   /note="ORF"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YN94"
FT                   /protein_id="CAA77148.1"
FT                   /translation="MSRLGASFKSLTFAVRSDYIISRIWRAFNTVGVLHFFGTDTTTTV
FT                   VKEFSAAGPIVPLRKSCFPFSVRAAVRAI"
FT   misc_feature    1443. .1446
FT                   /note="junction site"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   variation       77
FT                   /replace="c"
FT                   /note="in full length T317"
FT   variation       96
FT                   /replace="a"
FT                   /note="in full length T317"
FT   variation       116
FT                   /replace="a"
FT                   /note="in full length T317"
FT   variation       328
FT                   /replace="t"
FT                   /note="in full length T317"
FT   variation       331
FT                   /replace="a"
FT                   /note="in full length T317"
FT   variation       410
FT                   /replace="t"
FT                   /note="in full length T317"
FT   variation       967
FT                   /replace="c"
FT                   /note="in full length T317"
FT   variation       1113
FT                   /replace="c"
FT                   /note="in full length T317"
FT   variation       1502
FT                   /replace="a"
FT                   /note="in full length T317"
XX
SQ   Sequence 1970 BP; 399 A; 513 C; 527 G; 531 T; 0 other;

y18369 Length: 1970  14-NOV-2006  Type: N  Check: 8768  ..

       1  aatttcgatt caaattcacc cgtacctccg gagctcgatc cggaccctgc
      51  gggacttggt gtaaatccca accagatggt tgctctacgc ccatagtatc
     101  aatacaacat gtcgagactc ggagctagct tcaagtcctt gactttcgct
     151  gtacgcagcg attacataat ttcgcgcatc tggcgcgcct ttaataccgt
     201  tggagtcctg cacttcttcg gcactgatac aaccactacg gtggttaagg
     251  agttttcggc tgctgggccg atcgtccctt tacggaaatc ctgttttccg
     301  ttctctgttc gcgctgctgt tcgcgcgatt taagctgccg gacgtcctat
     351  tgacgctccg cgctccggat gcctctgtgg cctccctgtt ttcgacacat
     401  ctggtgtcgc gcgtccccgc tctgttgcgg gcgcttggag gtatgctctg
     451  tgtaaacctc cccttactgc tgccgccaag aagtccattc gcaaggcgaa
     501  gaaagattct gcattctttc tcagccgggc ttcttctctc ttctctcggg
     551  aagtcccctg cggcacgcgt cacagacttc gcaggcgtgt tgcgaaacta
     601  gttgacccta ctgtgcgtga aagtccccaa gacaagacta aacttaaggg
     651  gcgccgatat ggcaaaaatt ctgacctccc gtatatgggg gaagcggcgt
     701  tggatgacat ccttcgctgg attgaggggg taaatcctcc gccgtcgatg
     751  gtcgccgttc cggtgcccat ctcttttggc actctgccca ctacggcttg
     801  gtgctctgag gccgacgccg ctgttctgcg gtgtcgctta gactatcacg
     851  ccgctgcgac ttcctttcgt aatgaaggga agcacgtgag atacgtctat
     901  aatgacgtgt cttccgctgc caaccgtcct cgtacggttt ctccccgcaa
     951  gtgcgggcgt attttttcca gcggttctgc gctgggtgtt gaggttccaa
    1001  gtactaggga ccgccacacc gctttcgtga gatctactca cgctagcgtt
    1051  ttcttttctg acgcggttcg ccgcgttcga atgttccgtc ctgggcggaa
    1101  taatttcttt actagcgtcg tcagtgggcg gcgcgttagt tactttagac
    1151  ccggacctaa cggtacggtg tctgttctaa tgtcggatgg cgtcaatacg
    1201  gcgcgtctcg acgttgtcgc tcccgcgtac tatgcgtacg caaaaacgtt
    1251  gggcgccaga gtgcgctgtt tgtgggagtc gtccgatttg gacgatgcta
    1301  aaatacgtga cggtcaatgc tacattcgtc acgtgtacga cgtggcccta
    1351  tattttggga ggcgcgtcga cctttctgtg cgccgcactt tgggtttatt
    1401  ccccacagtg ggtgcgttaa aggcttatct tgttcgcgag tatggttttg
    1451  tacaccaagg aaaggcaatt ggcggtcgat ttagccgctg aaagggagaa
    1501  ggcgagactg gctcgtagac acccaatacg ttctccggaa gaaactccgg
    1551  aacattataa attcggtatg actgctaagg caatgttacc ggacatcaac
    1601  gccgtagacg ttggtgataa cgaggaaact tcgtcggagt acccagtgag
    1651  tctgagtgtt tctggcggag ttctccgtga acaccacttc atctgattga
    1701  agtggacgga ataagttcct tgcggaactt taagtcgggt tggtaaaaac
    1751  cctttatgat ggtgatgtat cactagacaa taaccggatg ggtaaagtct
    1801  ttaaaatgat cgaggggaaa attaaccgta tcctctcgtt ggtctaagct
    1851  cccacagagt ggtagtggtc tcaagtgagg cttaacgtat gcgtgaacca
    1901  aagaagttct ccttagagtg tgtgttgttt acccaacaca ctgtccctat
    1951  ggggggccaa cataggtcca