Sequence of DPV Citrus tristeza virus

Citrus tristeza virus defective RNA, strain T318

ACC No: Y18370

Dated: 2006-11-14 | Length: 1968 | CRC: -1148271657

                
ID   Y18370; SV 1; linear; genomic RNA; STD; VRL; 1968 BP.
XX
AC   Y18370;
XX
DT   11-DEC-1998 (Rel. 58, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 4)
XX
DE   Citrus tristeza virus defective RNA, strain T318
XX
KW   defective variant.
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RX   PUBMED; 10092024.
RA   Ayllon M.A., Lopez C., Navas-Castillo J., Mawassi M., Dawson W.O.,
RA   Guerri J., Flores R., Moreno P.;
RT   "New defective RNAs from citrus tristeza virus: evidence for a
RT   replicase-driven template switching mechanism in their generation.";
RL   J. Gen. Virol. 80:817-821(1999).
XX
RN   [2]
RP   1-1968
RA   Moreno P.;
RT   ;
RL   Submitted (05-NOV-1998) to the EMBL/GenBank/DDBJ databases.
RL   P. Moreno, Instituto Valenciano de Investigaciones Agrarias, Apartado
RL   Oficial 46113 Moncada, Valencia, SPAIN
XX
CC   Related sequences Y16840, Y16845
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1968
FT                   /organism="Citrus tristeza virus"
FT                   /specific_host="citrus"
FT                   /strain="T318 from Spain"
FT                   /mol_type="genomic RNA"
FT                   /note="CTV(T318) D-RNA 1.9 kb"
FT                   /db_xref="taxon:12162"
FT   5'UTR           <1. .109
FT   CDS             110. .334
FT                   /note="ORF"
FT                   /db_xref="UniProtKB/TrEMBL:Q9WIE2"
FT                   /protein_id="CAA77149.1"
FT                   /translation="MSKLGASFKSLTFAVRSDYIISRIWRAFNTVGVLHFFGTDTTTTV
FT                   VKEFSAAGPIVPLRKSCFPFSVRAAVRAI"
FT   misc_feature    1441. .1444
FT                   /note="junction site"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   variation       1
FT                   /replace=""
FT                   /note="in full length T318"
FT   variation       99
FT                   /replace="a"
FT                   /note="in full length T318"
FT   variation       286
FT                   /replace="g"
FT                   /note="in full length T318"
FT   variation       332
FT                   /replace="a"
FT                   /note="in full length T318"
FT   variation       522
FT                   /replace="t"
FT                   /note="in full length T318"
FT   variation       688. .691
FT                   /replace="ggggg"
FT                   /note="in full length T318"
FT   variation       734
FT                   /replace="t"
FT                   /note="in full length T318"
FT   variation       814
FT                   /replace="g"
FT                   /note="in full length T318"
FT   variation       973
FT                   /replace="g"
FT                   /note="in full length T318"
FT   variation       984. .985
FT                   /replace="ggg"
FT                   /note="in full length T318"
FT   variation       1149
FT                   /replace="c"
FT                   /note="in full length T318"
FT   variation       1400. .1402
FT                   /replace="cccc"
FT                   /note="in full length T318"
FT   variation       1446
FT                   /replace="t"
FT                   /note="in full length T318"
XX
SQ   Sequence 1968 BP; 403 A; 513 C; 521 G; 531 T; 0 other;

y18370 Length: 1968  14-NOV-2006  Type: N  Check: 1236  ..

       1  caatttcgat tcaaattcac ccgtacctcc ggagctcgat ccggaccctg
      51  cgggacttgg tgtaaatccc aaccagacgg ttgctctacg cccataatgt
     101  caatacaaca tgtcgaaact cggagctagc ttcaagtcct tgactttcgc
     151  tgtacgcagc gattacataa tttcgcgcat ctggcgcgcc tttaataccg
     201  ttggagtcct gcacttcttc ggcactgata caaccactac ggtggttaag
     251  gagttttcgg ctgctgggcc gatcgtccct ttacgaaaat cctgttttcc
     301  gttctctgtt cgcgctgctg ttcgcgcgat ttaagctgcc ggacgtccta
     351  ttgacgctcc gcgctccgga tgcctctgtg gcctccctgt tttcgacaca
     401  tctggtgtcg tgcgtccccg ctctgttgcg ggcgcttgga ggtatgctct
     451  gtgtaaacct ccccttactg ctgccgccaa gaagtccatt cgcaaggcga
     501  agaaagattc tgcattcttt cgcagccggg cttcttctct cttctctcgg
     551  gaagtcccct gcggcacgcg tcacagactt cgcaggcgtg ttgcgaaact
     601  agttgaccct actgtgcgtg aaagtcccca agacaagact aaacttaagg
     651  ggcgccgata tggcaaaaat tctgacctcc cgtatatggg gaagcggcgt
     701  tggatgacat ccttcgctgg attgaggggg taaatcctcc gccgtcgatg
     751  gtcgccgttc cggtgcccat ctcttttggc actctgccca ctacggcttg
     801  gtgctctgag gccaacgccg ctgttctgcg gtgtcgctta gactatcacg
     851  ccgctgcgac ttcctttcgt aatgaaggga agcacgtgag atacgtctat
     901  aatgacgtgt cttccgctgc caaccgtcct cgtacggttt ctccccgcaa
     951  gtgcgggcgt atttttccca gctgttctgc gctggtgttg aggttccaag
    1001  tactagggac cgccacaccg ctttcgtgag atctactcac gctagcgttt
    1051  tcttttctga cgcggttcgc cgcgttcgaa tgttccgtcc tgggcggaat
    1101  aatttcttta ctagcgtcgt cagtgggcgg cgcgttagtt actttagatc
    1151  cggacctaac ggtacggtgt ctgttctaat gtcggatggc gtcaatacgg
    1201  cgcgtctcga cgttgtcgct cccgcgtact atgcgtacgc aaaaacgttg
    1251  ggcgccagag tgcgctgttt gtgggagtcg tccgatttgg acgatgctaa
    1301  aatacgtgac ggtcaatgct acattcgtca cgtgtacgac gtggccctat
    1351  attttgggag gcgcgtcgac ctttctgtgc gccgcacttt gggtttattc
    1401  ccacagtggg tgcgttaaag gcttatcttg ttcgcgagta tggttttgta
    1451  caccaaggaa aggcaattgg cggtcgattt agccgctgaa agggagaaga
    1501  cgagactggc tcgtagacac ccaatacgtt ctccggaaga aactccggaa
    1551  cattataaat tcggtatgac tgctaaggca atgttaccgg acatcaacgc
    1601  cgtagacgtt ggtgataacg aggaaacttc gtcggagtac ccagtgagtc
    1651  tgagtgtttc tggcggagtt ctccgtgaac accacttcat ctgattgaag
    1701  tggacggaat aagttccttg cggaacttta agtcgggttg gtaaaaaccc
    1751  tttatgatgg tgatgtatca ctagacaata accggatggg taaagtcttt
    1801  aaaatgatcg aggggaaaat taaccgtatc ctctcgttgg tctaagctcc
    1851  cacagagtgg tagtggtctc aagtgaggct taacgtatgc gtgaaccaaa
    1901  gaagttctcc ttagagtgtg tgttgtttac ccaacacact gtccctatgg
    1951  ggggccaaca taggtcca