Sequence of DPV Hordeum vulgare BARE-1 virus

H.vulgare DNA for BARE-1 copia-like retroelement

ACC No: Z17327

Dated: 2002-07-07 | Length: 13271 | CRC: 1170780195

                !!NA_SEQUENCE 1.0
ID   HVBARE1    standard; genomic DNA; PLN; 13271 BP.
XX
AC   Z17327;
XX
SV   Z17327.1
XX
DT   03-SEP-1993 (Rel. 36, Created)
DT   07-JUL-2002 (Rel. 72, Last updated, Version 9)
XX
DE   H.vulgare DNA for BARE-1 copia-like retroelement
XX
KW   BARE-1 element; copia element; transposable element.
XX
OS   Hordeum vulgare
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; Pooideae;
OC   Triticeae; Hordeum.
XX
RN   [1]
RP   1-13271
RX   MEDLINE; 93363916.
RX   PUBMED; 7689350.
RA   Manninen I., Schulman A.H.;
RT   "BARE-1, a copia-like retroelement in barley (Hordeum vulgare L.).";
RL   Plant Mol. Biol. 22(5):829-846(1993).
XX
RN   [2]
RP   1-13271
RA   Schulman A.;
RT   ;
RL   Submitted (22-OCT-1992) to the EMBL/GenBank/DDBJ databases.
RL   Schulman A., Institute of Biotechnology, University of Helsinki, P.O. Box
RL   56, Viikinkaari 9, Biocentre 1, FIN-00014 Helsinki, Finland
XX
DR   GrainGenes; Z17327; Z17327.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .13271
FT                   /db_xref="taxon:4513"
FT                   /mol_type="genomic DNA"
FT                   /organism="Hordeum vulgare"
FT                   /strain="NK 1558"
FT                   /dev_stage="7-day old seedling"
FT   repeat_region   309. .12397
FT                   /note="retrotransposon"
FT                   /transposon="BARE-1"
FT   repeat_unit     304. .308
FT                   /citation=[1]
FT                   /function="direct repeat in host DNA caused by BARE-1
FT                   insertion"
FT                   /rpt_type=DIRECT
FT   repeat_unit     12398. .12402
FT                   /citation=[1]
FT                   /function="direct repeat in host DNA caused by BARE-1
FT                   insertion"
FT                   /rpt_type=DIRECT
FT   LTR             309. .2137
FT                   /citation=[1]
FT                   /function="5' LTR"
FT   repeat_unit     309. .314
FT                   /citation=[1]
FT                   /function="LTR terminal inverted repeat"
FT                   /rpt_type=INVERTED
FT   repeat_unit     complement(2142. .2147)
FT                   /citation=[1]
FT                   /function="LTR terminal inverted repeat"
FT                   /rpt_type=INVERTED
FT   misc_feature    complement(1. .303)
FT                   /citation=[1]
FT                   /function="rye R173-1 homologous region, interrupted by
FT                   BARE-1 insert"
FT   misc_feature    complement(12404. .12717)
FT                   /citation=[1]
FT                   /function="rye R173-1 homologous region, interrupted by
FT                   BARE-1 insert"
FT   TATA_signal     1293. .1299
FT                   /citation=[1]
FT   misc_signal     1333. .1340
FT                   /function="putative 5' cap site"
FT   TATA_signal     1666. .1673
FT                   /citation=[1]
FT   misc_signal     1689. .1696
FT                   /citation=[1]
FT                   /function="putative 5' cap site"
FT   polyA_signal    1485. .1489
FT   primer_bind     2139. .2157
FT                   /citation=[1]
FT                   /note="complementary to 3' end of initiator methionyl tRNA"
FT                   /standard_name="putative (-)-strand primer binding site"
FT   prim_transcript 1335. .11760
FT                   /citation=[1]
FT                   /note="Putative primary transcript estimated from putative
FT                   TATA box to polyadenylation signal in 3' LTR + 30 bases."
FT                   /function="putative primary transcript"
FT   prim_transcript 1666. .11760
FT                   /citation=[1]
FT                   /note="Putative primary transcript estimated from putative
FT                   TATA box to polyadenylation signal in 3' LTR + 30 bases."
FT                   /function="putative primary transcript"
FT   CDS             join(3392. .4540,4539. .7292)
FT                   /citation=[1]
FT                   /note="Frameshift at 4541. Stop codons at 3992,5652,5988,
FT                   6519. Includes putative gag,aspartic proteinase,
FT                   endonuclease,reverse transcriptase,RNase H domains"
FT                   /note="conceptual translation: MAHARVTLNFNTFLEKAKLKDDGSNFV
FT                   DWAHNLIKLLLQAGKKDYVLNRALGDEPPATADQDVKNAWLTRKEDYSVVQRAVLYGL
FT                   EPGLQRRFERHGAYEMFQELKFIFQKNTRIERYETFDKFYACKMEENSSVSEHVLKMA
FT                   GYSSRLAELGIELPQEAITDRILQSLPPSYKGFLLNYNMQGMNKSPGELFAMLKVVEE
FT                   LRKEHQVLMVNKTTSFKRNDKGKKGSSKKSGKPVANPTKKPKAGPKPETECYYCKGMG
FT                   HWKRNCPKYLADKKAAKEKSGIFDIHVIDVYLTSSRSSAWVFDTGSVAHICNSKQELR
FT                   NKRRLAKDEVTMRVGNGSKVDAIAVGTISLQLPSGLVMNLNNCYLVSALSMNIIWILF
FT                   IARRLLVFKSENNGCSVSMSNIFYGHAPIVRGFFILNLDSDNTHIHNIETKRVRVNND
FT                   SAMFLWHCRLGHIGVKRMKKLHTDGLLESLDTCEPCLMGKMTKTPFSGTMERASDLLE
FT                   IIHTDVCDPMSVEARSGYHYFLTFTDDLSRYGYVYLMKHKSETFEKFKQFQSEVENHY
FT                   NKKIKFLRSDRGGEYLSFEFGAHLRQCGIVSQLTPPGTPQCNGVSERRNRTLLEMVRS
FT                   MMYITDLPLSFWGYLLKTAAFTLNRAPSKSVEMTPYELWYGNRPKLSFLKVWGYDAYV
FT                   KKLQPEYLEPKAEKCVFIGYPKETVGYTFHLKSEGKVFVAKNEAFLEKEFLSRELSGR
FT                   KIELDAVVEPLIPLDGGARQGETPVVVMPGEEVNDDDHETPDQVPVESRRSTRPRTTR
FT                   EWYGNPVLSIMLLDNNEPTNYEEAMMGPDSNKWLEAMKSEIGSMYENKVWTLEVLPEG
FT                   CKAIQNKWIFKKKTGADSNVTVYKALVAKGFSQVQGIDYDETFSPVAMLKSVRIMLAI
FT                   AAFFDYEIWQMDVKAAFLNGLLKEELYMMQPEGFVDPKNANKACKLQGSIYGLVQASR
FT                   SWNKRFGEVIKAFGFIQVVGESCIYKKVSGSSVAFLILYVDDILLIGNGVEFLENIKD
FT                   YLNKSFSMKDLGEAAYILGIKIYRDRSRVIGLSQSTYLDKVLKRFKMEQSKKGLLPVL
FT                   QGTRLSKTQCPATDKDIEHMSTVPYASAIGSIMYAMLCIRPDVSLAISMAGRFQSNPG
FT                   VDHWMAVKNILKYLKRTTEMFLVYGGDKELAVKGYVDASFDTDPDDSKSQTGYVFILN
FT                   GGVVSWCSSKQSVVADSTCEAEYLAASEATKEGVWMKQLMTDLGVVSSALNPITLFCD
FT                   NMGVIALAKEPQFHKNTIRIKRRFNLIRDYVEEEDVNICKVHMDLNVAPAD"
FT                   /pseudo
FT                   /product="BARE-1 polyprotein"
FT   mat_peptide     join(4235. .4540,4539. .4592)
FT                   /citation=[1]
FT                   /note="Potential active site at 4298"
FT                   /product="putative aspartic proteinase"
FT                   /gene="pro"
FT   misc_binding    4148. .4189
FT                   /citation=[1]
FT                   /bound_moiety="nucleic acid"
FT                   /function="potential nucleic acid binding domain of put.
FT                   gag protein"
FT   primer_bind     7396. .7410
FT                   /citation=[1]
FT                   /note="polypurine tract as putative (+)-strand priming
FT                   site"
FT                   /standard_name="(+)-strand primer binding site"
FT   LTR             7412. .12397
FT                   /citation=[1]
FT                   /note="Insertion into LTR: 7558. . .10692. 96% identical to
FT                   5' LTR"
FT                   /function="3' LTR"
FT                   /standard_name="LTR"
FT   misc_feature    2967. .3615
FT                   /citation=[1]
FT                   /product="rye R173-1 homologous region"
FT   repeat_unit     7412. .7417
FT                   /citation=[1]
FT                   /note="imperfect"
FT                   /function="LTR terminal inverted repeat"
FT                   /rpt_type=INVERTED
FT   repeat_unit     complement(12392. .12397)
FT                   /citation=[1]
FT                   /note="imperfect"
FT                   /function="LTR terminal inverted repeat"
FT                   /rpt_type=INVERTED
XX
SQ   Sequence 13271 BP; 3417 A; 2837 C; 3291 G; 3726 T; 0 other;

   Z17327  Length: 13271  May 9, 2005 17:26  Type: N  Check: 4248  ..

       1  ttgtgttctc ccatatgtgc atcgttgcga aggttcatcg tttcaagaca
      51  tcacgtgatg atcgggtgcg atagactcta cgttcgcata caacgggtgt
     101  aagccagttt tacacataca taacacttgg gttaaacttg acaagcctag
     151  catgtataga tatggacttg gaacacaata gaccgaaatg tcgaacatga
     201  gtcacatagt agatatgatc aatacggaga tgttcaccat tgaaaccacc
     251  tcatctcatg tgatgatcag acttggattg gtggatatgg atcatgtcac
     301  actcgaactg ttggaattat gccctagagg caatgataaa taatttatta
     351  ttataattca tgtatcaaga taatcgttta ttatccatgc tataattgtg
     401  ttgaatgaag acttagatac atgtgtggat acatagacaa aatactgtcc
     451  ctagcaagcc tctagttggc tagccagttg atcaaggata gtcagggtct
     501  tctggctatg tacaaggtgt tgttgcttga tgactggatc acatcatcgg
     551  gagaatcatg tgatggacta gacccaaact aatagacgta gcatgttgat
     601  cgtgtcattt tgtagctact gttttctgca tgtcaagtat ttattcctat
     651  gaccatgaga tcatataact cactgacacc ggaggaatgc tttgtgtgta
     701  tcaaacgtca caacgtaact gggtggctat aaagatgctc tacaggtatc
     751  tccgaaggtg tccgttgagt tagtatggat caagactggg atttttcact
     801  ccgtgtgacg gagaggtatc tcggggccca ctcggtaata caacatcaca
     851  cacaagcctt gcaagcaatg tgacttaggg taagccacgg gatcttgtat
     901  tacgggacaa gtaaagagac ttgccggtaa acaagattga aataggtatg
     951  cggatactga cgatcgaatc tcggggcaag taccataccg aaggacaaag
    1001  ggaatgacat acgggattat atgaatcctt gccactgagg ttcaaacgat
    1051  aagatcttcg tagaatatgt aggatgcaat atgggcatca aggtcccgct
    1101  attggatatt gaccgaggag tccctcggtc atgtctacat agttctcgaa
    1151  cccgcagggt ctgcacactt aaggttcgac gttgttttat gcatatttga
    1201  gttatatggt tggttaccga atgttgttcg gagtcccgga tgagatcacg
    1251  gatgtcacga gggtttccga gatggtccga aaatgaagat tgatatatag
    1301  gatgacctca tttgattacc ggaaaggttt cggcattacc gggaatgtac
    1351  cgggagtgac gaatgggttc cggatgttca ccggggaggg ggggcagccc
    1401  actccaggga agcccatagg ccttaggggt gccacaccag cccttagtgg
    1451  gctggtgggc aagcccaaga aggctcctgc gcaggataag agaaaatcaa
    1501  acagaaaagg aaaaaaaagg gaagtgggga aagagaggag gactccacct
    1551  tccagtccta gttggactag gattggagga ggaatcctcc tccccccttc
    1601  gaccgaaccc cttggggctc cttgagcctc aaggcaaggc ccctcccctc
    1651  cctcctatat atactgaggt attagggctg atttgagaca acttttccac
    1701  cgcagcccga ccacatacct ccacggtttt tcctctagat cgcgtttctg
    1751  cggagctcgg gtggagccct gctgagatta gatcaccacc aacctccgga
    1801  gcgtcgtcag gcttccggag aactcatcta cctttccgtc tctcttgctg
    1851  gatcacgaag gccgagatca ccatcgtgtt gtacgtgtgc tgaacgcgga
    1901  ggtgtcgtcc gttcggcact agattagagc ggatcgtggg acggatcgcg
    1951  ggacggttca cggggcggat cgagggacat gaggacgttc cactacatca
    2001  accgcgttta ttaacatttc tgttatgcga tctacaaggg tacgtagatt
    2051  tgaaatcccc ctcatagatg gacatcacca tgacaggtct tcgtgcgcgt
    2101  aggaattttt ttgtttccca tgcgacgttc cccaacattg gcatcgtgag
    2151  ctaggttcat gcgtagatgt catctcgagt agaacacaaa tttttttgtg
    2201  ggcggtgatg tgtgatttgc tgccctcctt agtcttttct tgattccgcg
    2251  atattgttgg atcgaagcgg ctcggaccga cattactcat acgcttacga
    2301  gaggctggtt tcatcgctat gagcaacccc gttgctcaaa gatgactgac
    2351  gagtgtcggt ttctccaact ttagttgaat cggatttgac cgaggaggtc
    2401  cttggatgag gttaaatagc aattcatata tctccgttgt ggtgtttgcg
    2451  taagtaagat gcaatcctac tagataccca tggtcaccac gtaaaacatg
    2501  caacaacaat tagaggacgt ctaacttgtt tttgcagggt atgcttgtga
    2551  tgtgatatgg acgacgatgt gatgtgatat attggatgta tgagatgatc
    2601  atgttgtaat agttaatatc gacttgcacg tcgatggtac ggcaaccggc
    2651  aggagccata gggttgtctt taaactaatg tttgtgcttg cagatgcgtt
    2701  tactatattg ctaggatgta gctttagtag taatagcatg agtagcacga
    2751  caaccccgat ggcgacacgt tgatggagat catggtgtgg cgccggtgac
    2801  aagaagatca tgccggtgct ttggtgatgg agatcaagaa gcacgtgatg
    2851  atggccatat catgccactt atgaattgca tgtgatgtta atccttttat
    2901  gcaccttatt ttgcttagaa cgacggtagc attatgaggt gatctctcac
    2951  taaaatttca agacgaaatt gtgttctcgc cgactgtgca ccgttgctac
    3001  agtttgtcgt ttcgagacac cacgtgatga tcgggtgtga tagactgaac
    3051  gttcacatac aacgggtgca aaacagttgc acacgtggaa cactcgggtt
    3101  aagcttgacg agcctagcat gtggagacat ggtctcagaa cacatgagac
    3151  cgaaaggtcg atcatgaatc atatagttga tatgattagc atagggatgc
    3201  ttaccactga aactatcctc aactcacgtg atgaccggac ttgagctagt
    3251  ggaattggat catgaaccac tcaaatgact agagatatgt actttttgag
    3301  tgggagttta gcaagtaatt tgattaagtt aaactctaat tatcttgaac
    3351  atagtctaag tccactttga atatatttgt gttgtagatc aatggctcac
    3401  gcgagagtca ccctgaattt taatacgttc ctagagaaag ctaagttgaa
    3451  agatgatgga agcaactttg tagactgggc tcataatcta attaagttgc
    3501  tcctgcaagc tgggaagaag gattatgtcc ttaatgctgc gctaggagat
    3551  gaaccacccg ctacggctga ccaagatgtt aagaacgctt ggttaacacg
    3601  taaggaggac tactcagtag ttcaacgtgc agtcttgtat ggcttagagc
    3651  cgggacttca acgtcgcttt gagcgtcatg gagcatatga gatgttccag
    3701  gagttgaagt ttatctttca gaagaacacc cggatcgaga ggtatgagac
    3751  ctttgataaa ttctatgctt gcaagatgga ggagaattcg tctgtcagtg
    3801  aacatgtgct caaaatggct gggtactcaa gccgtctagc tgagctgggg
    3851  attgaactcc cgcaagaggc tatcactgac agaattcttc aatcactgcc
    3901  gccaagctat aagggctttt tgttgaacta caacatgcaa gggatgaaca
    3951  agtcacccgg cgagttgttt gcgatgctga aagtcgtaga gtgagaactc
    4001  cgtaaagagc atcaagtgtt gatggtgaat aagaccacta gtttcaagag
    4051  aaacgacaaa ggaaagaagg gtagttcgaa gaagagcggc aagcctgttg
    4101  ccaatccgac gaagaaaccc aaagctggtc ctaagcctga aacggagtgc
    4151  tattattgca agggtatggg tcactggaag cgcaactgcc ccaagtatct
    4201  ggctgataag aaggcggcca aagaaaaatc aggtatattt gatatacatg
    4251  ttattgatgt gtacttaacc agttctcgta gtagtgcctg ggtattcgat
    4301  accggttctg ttgctcatat ttgcaactca aaacaggaac tgcggaataa
    4351  gcgaaggctg gcgaaggatg aagtgacgat gcgcgtggga aatggttcca
    4401  aggttgatgc aatcgccgtc ggcacaattt cacttcagtt accatcagga
    4451  ttagttatga acttaaataa ttgttattta gtgtctgcgt taagcatgaa
    4501  cattatatgg atactgttta ttgcgagacg gttactcgtt taagtcagag
    4551  aataatggtt gctctgtttc tatgagtaat atcttttatg gtcatgcacc
    4601  cattgtgaga ggatttttca tattgaatct tgatagtgat aatacacata
    4651  tacataacat tgagaccaaa agagttagag ttaacaatga tagcgccatg
    4701  tttttatggc actgccgctt aggtcatatt ggtgtaaagc gcatgaagaa
    4751  actccatacc gatggacttt tggagtcact tgacacgtgc gaaccatgcc
    4801  tcatgggcaa gatgactaaa actccgttct ccggaacaat ggagcgtgca
    4851  agtgacttgt tggaaatcat acataccgat gtgtgtgatc cgatgagtgt
    4901  ggaggcacgc agcggatatc attattttct caccttcact gacgatttga
    4951  gtagatatgg ttatgtctac ttgatgaagc acaagtctga aacatttgaa
    5001  aagttcaagc aatttcagag tgaagttgaa aatcattata acaagaagat
    5051  caagttccta cggtctgatc gtgggggtga atatctgagt ttcgagtttg
    5101  gtgctcactt aagacaatgt ggaattgttt cacagttgac accgcctgga
    5151  acaccacagt gtaatggtgt gtccgaacgt cgtaatcgta ctttattaga
    5201  gatggtgcga tctatgatgt atattaccga tttgccgtta tcgttttggg
    5251  gttatttatt aaaaacagct gcattcactt taaatagggc accatcaaaa
    5301  tctgttgaga tgacaccata cgaactgtgg tatggcaata gaccaaagtt
    5351  gtcgtttctt aaagtttggg gatatgatgc ttatgtcaaa aagcttcagc
    5401  ctgaatatct ggaacccaaa gcggaaaagt gcgtcttcat aggttacccg
    5451  aaagagacag ttgggtatac cttccatctc aaatccgagg gcaaagtgtt
    5501  tgttgctaag aacgaagctt ttctcgagaa ggagtttctc tcgagagaat
    5551  tgagtgggag gaagatagaa cttgatgcgg ttgtcgaacc tctcatccct
    5601  ctggatggtg gcgcaaggca aggagaaacc cctgtcgttg tgatgccggg
    5651  ataggaggaa gttaatgatg atgatcatga aactccggat caagttcctg
    5701  tcgaatctcg caggtcgacg agaccgcgta ctactcgaga gtggtacggt
    5751  aatcccgtct tatcaattat gttgttggac aacaatgaac ctacgaatta
    5801  tgaagaagca atgatgggcc cagattccaa caaatggctg gaggccatga
    5851  agtccgagat aggatctatg tatgaaaaca aagtgtggac tttggaagta
    5901  ctacctgaag gctgcaaggc tattcagaac aaatggatct ttaagaagaa
    5951  gacgggcgct gacagtaatg tgaccgttta taaagcttga cttgtggcaa
    6001  agggtttttc acaagttcaa gggattgact acgatgagac attctcaccc
    6051  gtagcgatgc ttaagtccgt ccgaatcatg ttagcaatag ctgcattttt
    6101  cgattatgaa atctggcaga tggatgtcaa agcggcgttc cttaacggtc
    6151  tccttaagga agagttgtat atgatgcaac ccgaaggttt tgtcgatcct
    6201  aaaaatgcta acaaagcgtg caagctccag ggatccattt atggactggt
    6251  gcaagcatct cgaagttgga ataaacgctt tggtgaggtg atcaaagcat
    6301  ttgggtttat acaagtggtt ggagaatctt gtatttacaa gaaggtgagt
    6351  gggagctctg tggcgttcct aatactatat gtggatgaca tattactgat
    6401  tggaaacggc gtggagtttt tggagaacat aaaggattac ttgaataaaa
    6451  gtttctctat gaaggaccta ggagaagctg cttacattct aggcattaag
    6501  atctataggg atagatcata acgcgtgata ggactttcac aaagcacgta
    6551  ccttgataaa gttttgaaga ggttcaaaat ggaacagtcc aagaaggggc
    6601  tcttgccagt tttacaaggt acgagattga gtaagactca gtgcccagca
    6651  actgataaag atatagagca tatgagcacc gtcccctatg cttcagccat
    6701  aggttctatc atgtatgcaa tgttgtgcat tagaccggac gttagcctgg
    6751  ccataagtat ggcaggcagg ttccagagta atccaggagt ggatcactgg
    6801  atggcggtca agaatatcct gaagtacctg aaaaggacta cggagatgtt
    6851  tctcgtatat ggaggtgaca aagagctcgc cgtaaagggt tacgtcgatg
    6901  caagctttga cacagatccg gacgactcta agtcgcagac cggatatgta
    6951  tttattctta atgggggtgt ggtaagctgg tgcagttcca agcaaagcgt
    7001  cgtagctgat tctacatgtg aagcggagta cttggctgcc tcggaggcaa
    7051  ctaaggaagg tgtgtggatg aagcagttaa tgacggatct tggagtggtg
    7101  tcgagcgcac tgaatccaat aaccctgttt tgtgacaaca tgggtgtcat
    7151  tgccttagca aaggaaccgc agtttcacaa gaataccata cgcatcaaac
    7201  gacgcttcaa cctcatccgc gactacgtcg aggaggagga cgtgaatata
    7251  tgcaaagtgc acatggatct gaatgtagca cccgctgact aaacctcttc
    7301  cacgggcaaa gcatgatcaa caccagaagt gtatgggtgt tagatttatt
    7351  ataatgtaat tcgcatggtg atgtgagggc tagattattg actctagtgc
    7401  aagtgggaga ctgtcggaat tatgccctag aggcaatgat aaataagtta
    7451  ttattataat tcctgtatca agataatcgt ttattatcca tgctataatt
    7501  gtgttgaatg aagacttaga tacatgtgtg gatacataga caaaacactg
    7551  tccctagtgt gacagcccga tgccgacgtt ccagaagatt ccccccttta
    7601  tcccgttttt gtcgtgtgtc tattttattt tgtcgcatca tcatcgcatc
    7651  attcgcatca tctgcattgc atcggcaccc cgttgccgcc agttttcaaa
    7701  aacttgcatc cgttggtagt tgccggttct cgtcgttgcc cattctgagt
    7751  ccgaccacac tcccacgcgt ccgcggcatc gtcaaacctt gttttaaaag
    7801  tgtgagtaaa actttccctg attgggttga gattttacgc gcggtcttta
    7851  ttagatatag ctaggctgcc tgtcgaattt cgtcgcgatc ggggttcgta
    7901  tggtacccga acggtcgacc gtagcggcac cgtattcggt ctaccgtcgg
    7951  acgtttgtcg gtgttttaaa aattcgttgc cgcaccgccc attctccctc
    8001  tcgtccctgg atatcccctc tacatggcct cgtaaccgtt cccgcgttca
    8051  gaattagccg aatccgaccg cgcggttgaa accggggcgg gatttcgcta
    8101  aacctagccc cctcttctct atatatagcc cctcctacta gtattttgga
    8151  cagcagcccc cctgcctcat tttgtgcgcc acctaccccg aaaccctagc
    8201  tcccgcagcc tctctctccc accagcgccg ccggcccgcc aggcccgatc
    8251  cagcccgcct tgggcccaga ttcgccgccc ccgcgagctc ccccagctcc
    8301  agcaccatgg cctcccgagc tccctgccca cctcgcgtgc gcgccgcccc
    8351  agctccccgt gtcgccccgc agtcgccgcc ggcagctcgc cggagagccc
    8401  cgccggaccc aggccggagc tccctatgct cctctctctt cttctctccc
    8451  tcacccgtat ctctctcttc ccgcaggttc cgaggtcgcc gccaccgccc
    8501  cgttctacgc ctccgccgcg tggatccggt gtggagatga cagatccggc
    8551  cggcctccgc cgcccggtcc gttttcggcc gctccagtct cgctcgtgac
    8601  ccgctgccat cgtcagggtc gttgcgagga gccatggcgc tgcgtgctgt
    8651  ccatcgggag atcgagcctc cgccaccgcc tcgccagctc gtgggccgcg
    8701  caggagcagc caggctgcca gatccggccc agctaggtag cccccccatc
    8751  ggcctcctcc aggcttcctc caccgccagc ccaggccggt gtgcatcctc
    8801  cgcccgaggc ccagctccat ttccccagat ctggcccagg tgcacttggt
    8851  gagcgcagct atttccccgc ccccgttgca acattactac tttgcgctcg
    8901  ttgcctctta ggcccagtta ggaattcggc ccattatttt gttttatttt
    8951  aggtttgcga tctatttttt ttgagggttt agaatatatt cgatcgcccg
    9001  tatcttttta ttcgtgtgtc ggatcggaat gtgtagcata tggattttgt
    9051  gtagaattcc acgtagattt cgaatttcta acttgcataa ttatttgagg
    9101  cagtttgatg tgcctaatgc atcgttttgc gtgctgtttc aataggatcc
    9151  gttctgtagt tatttctcgt gcgtgtccgg attgcccgta taccgtagat
    9201  taaatgtcca tgttttaggg accatttttc catgtatttt agagcggtca
    9251  ttgtattttt gcgtgtaggg aattgccgct aatttatttt cccgcgtata
    9301  ggttttttct cgcatttatg tgtggcatta ttttgtattg caaccccaca
    9351  tattttatat gtttccgggg tagaaaaatc cattggattt ttctgtgcaa
    9401  ttagttttag cttttgagta agttagttct tgagatattt ttccgtgttg
    9451  ccctcttgtc attttcgtag gatttattcc gtgcttcgtt tgatcaagtt
    9501  gtcaactgga gagttgatct tgggtattta ctctagcccc tggtattttt
    9551  ggttgcaatg taaatgcatg tttaggtgtg gtttgattgc tctcaagttg
    9601  ctagaaatag tgctgatttg gaggagctga aatatttcta agtctggaat
    9651  ctgttattat tttgttgttg tcttgtcttg tttctatctt ttgttctgta
    9701  gctcttttga ggttggtgca atggagttag tggtaaccct tgtgattctc
    9751  tagcatgctg tgaattttca tgccatttgg agacctgtat cttatgattt
    9801  tctgctgtca atatggcttc agatcgaaaa ctgcactttc atgaggtgta
    9851  attttcacta agtttgaaat agtgtgtgag atgccatttt gtgccttctt
    9901  tccctagtga cggaaagtcg tgcccgcggt tatgtggcaa cgtggaagat
    9951  ttgtttaaca ctggttctag ataacttgaa gttaacttaa ttaaaatatg
   10001  ctaactatgt gtgtaaccgt gactgtctct ttcatgagtt atttctccga
   10051  tcgaggacac ggtggggtta tgtctgacgt aggtaggtgt ttcggatcat
   10101  tcatttgatc atcagtagtc acgtccgcta tgcgtagatc ttcccactct
   10151  tatttcttgt actcgtaagc tagccaccaa atatatgctt agccgctgct
   10201  gcaacctcac cacctaacca tgcctcaccc attaagcttt gctagtcttg
   10251  atacctttgg aaatgagatt gctgagtccc ctgtggctca cagattacta
   10301  caacaccagt tgcaggtaca tgtaaaggtt atttgacacg agcgcattga
   10351  ttgttcattt ggagttgctt cttcttcttc ttcttcatcg atctaggatg
   10401  ggttccaggc cggcagcctg ggatagcaag gatggacgtc gttcttcttt
   10451  tgtcgtttgt tttcgtccgt agtcggaccc tgctcttact cttgatgttt
   10501  atgtaatgta ttgatgtgac tctgatgtag cttgtggcga gtgtaagcca
   10551  attcaatata tatatctcat cttttcagta catgtacttg taacgatatc
   10601  cattcttgcg acacgacgag atgcgcttct atccctgacg aggccttcgt
   10651  gccaaatcga ggatagggtc gcatcttggg cgtgacacct agcaagcctc
   10701  tagttggcta gcgagttggt caaggatagt cagggtcttc tggctatgta
   10751  caaggtgttg ttgcttgatg actggatcac atcatcggga gaatcatgtg
   10801  atggactaga cccaaactaa tagacgtagc atgttgatcg tgtcattttg
   10851  tagctactgt tttctgcatg tcaagtattt attcctatga ccatgagatc
   10901  atataactca ctgacaccgg aggaatgctt tgtgtgtatc aaacgtcaca
   10951  acgtaactgg gtggctataa agatgctcta caggtatctc cgaaggtgtc
   11001  cgttgagtta gtatggatca agactgggat ttttcactcc gtgtgacgga
   11051  gaggtatctc ggggcccact cggtaataca acatcacaca caagccttgc
   11101  aagcaatgtg acttagggta agccacggga tcttgtatta cgggacaagt
   11151  aaagagactt gccggtaaac gagattgaaa taggtatgcg gatactgacg
   11201  atcgaatctc ggggcaagta acataccgaa ggacaaaggg aatgacatac
   11251  gggattatat gaatccttgg cactaaggtt caagcgataa gatcttcgta
   11301  gaatatgtag gatcaaatat gggtatctag gtcccgctat tggatattga
   11351  tcgaggagtc cctcgggtca tgtctacata gttctcgaac ccgcagggtc
   11401  tacacactta aggttcggca ttgttgtatg cgtatttgag ttatatggtt
   11451  ggttaccgaa tgttgttcgg agtcccggat gagatcacag acgtcatgag
   11501  ggtttccgga atggtccgga aacgaagatt gatatatagg atgacctcat
   11551  ttgattaccg gaaagttttc ggcattaccg ggaatgtacc gggagtgacg
   11601  aatgggttcc ggatgttcaa cggggggggg gggggggaca gcccaccccg
   11651  gggaagccca taggccttag gggtgccaca ccagccctta gtgggcttgt
   11701  gggcaagccc aagaaggccc ctgcgcagga taagagaaaa tcaaagagaa
   11751  aaggaaaaaa aggggaagtg gggaaagaga gaaggactcc accttccaat
   11801  cctagttgga ctaggattgg aggaggactc ctccgcctcc ccccttcggg
   11851  cgaacccctt ggggctcctt gagcctcaag gcaaggcccc tcccctccct
   11901  cctatatata ctgaggtatt agggatgatt tgagacaact tttccacggc
   11951  cgcccgacca catgcctcca cggtttttcc tctagatcgc gttcctacgg
   12001  agctcgggca gagcctgctg agattagctc accaccaacc tccggagcgc
   12051  cgtcacgctg ccggagaact catctacctc tccgtctctc ttgctggatt
   12101  aagaaggccg agatcatcgt cgtgctgtac gtgtgctgaa cgcggaggtg
   12151  tcgtccgttc ggcactagat cggagcggat cttgggacgg atcgcggaac
   12201  ggttcgtggg acggttcgtg gggcggatca agggacgtga ggacgttcca
   12251  ctacatcaac cgcgtttatt aacgcttctg ctgtgcgatc tacaagggta
   12301  cgtatatctg aaatccccct catagatgga catcaccatg acaggtcttc
   12351  gtgcgcgcgt aggaaatttt ttgtttccca tacgacgttt cccaacacga
   12401  acaacctgag ggatgttgag ttgagtggga gttcttaagt aatatgatta
   12451  attgaactca ttatcctgaa caatagtcta agttgtcttt gcaaattttg
   12501  ttgtagatca atggctcgcg cagcatttta atgcgttcct aagaaagcta
   12551  agctaaaaga agatagaagc aattttgcgg gccgggtctg taatctgagg
   12601  attagcctca cggcttcaca aaaggcttat gtccttgatg caccgcttgg
   12651  tttgccacct cctcgaacgt cgtttgtgga tgtcgtgaac gtctgccaac
   12701  cacgtgttga tgactacatg atagtttatt gcacgacggt gactacatgt
   12751  ctatggatgt tctgtggatg ttgatgacta cagaatagtt caatgcacca
   12801  cgtgtatcat tgcatcatac cataaattat cgttgaaggc ttcttgtata
   12851  ttcatcttcc atcttgagaa attatttgta taatttaaag agtctcccaa
   12901  aaaaccccgt ggaaaaaaaa tatgaggaga ataatataga tatgttgctg
   12951  aaactccttt aaactagtga aaatggaagg aaatgatgca acatataatg
   13001  attattgtct cctcgataac ccatataaga aaaaaccttt caagaaggag
   13051  aaaaatcgtt ggtgagttta gggaacaata gatgtgcttt gtatacattc
   13101  ctttaaaaaa ccttggaaaa aaagtattgc acatgtcgcc tcattaaaaa
   13151  ccttttatga gaaacttaga gagaaagctc ataaggaaaa agagtgtgat
   13201  atatgtcatt gaaaactcct ttaaaaatgt atacaatgta agaattattt
   13251  aaaaatgttg ttagcattca a