Sequence of DPV Tomato bushy stunt virus

Tomato bushy stunt virus mRNA for 22kDa and 19kDa proteins (isolate A23).

ACC No: Z68896

Dated: 2005-04-18 | Length: 876 | CRC: -1047666207

                !!NA_SEQUENCE 1.0
ID   TBSVISA23  standard; genomic RNA; VRL; 876 BP.
XX
AC   Z68896;
XX
SV   Z68896.1
XX
DT   26-JAN-1996 (Rel. 46, Created)
DT   18-APR-2005 (Rel. 83, Last updated, Version 7)
XX
DE   Tomato bushy stunt virus mRNA for 22kDa and 19kDa proteins (isolate A23).
XX
KW   19 kDa protein; 22 kDa protein.
XX
OS   Tomato bushy stunt virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Tombusvirus.
XX
RN   [2]
RP   1-876
RA   Fraile A.;
RT   ;
RL   Submitted (25-JAN-1996) to the EMBL/GenBank/DDBJ databases.
RL   Fraile A., E.T.S.Ingenieros Agronomos, Biotecnologia, Ciudad Universitaria,
RL   Madrid, Madrid, Spain, 28040
XX
RN   [3]
RP   1-876
RA   Luis-Areteaga M., Rodriguez-Cerezo E., Fraile A., Saez E.,
RA   Garcia-Arenal F.;
RT   "Different tomato bushy stunt virus strains cause disease outbreaks on
RT   solanaceous crops in Spain.";
RL   Phytopathology 86:535-542(1996).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .876
FT                   /db_xref="taxon:12145"
FT                   /mol_type="genomic RNA"
FT                   /organism="Tomato bushy stunt virus"
FT                   /isolate="TBSV_A23"
FT   CDS             1. .570
FT                   /db_xref="GOA:P50630"
FT                   /db_xref="InterPro:IPR005332"
FT                   /db_xref="UniProt/Swiss-Prot:P50630"
FT                   /product="22kDa protein"
FT                   /protein_id="CAA93125.1"
FT                   /translation="MDTEYEQVNKPWNELYKETTLGNKLMVNVGMEDQEVPLLPSNFLT
FT                   KVRVGLSGGYITMRRIRIKIIPLVSRKAGVSGKLYLRDISDTKGRKLHCTESLDLGREI
FT                   RLTMQHLDFSVSTRSDVPIVFGFEELVSPFLEGRELFSISVKWQFGLSKNCYSLPQSKW
FT                   KVMYQEDALKVLKPSKKKASKTGSSV"
FT   CDS             33. .551
FT                   /db_xref="GOA:P50625"
FT                   /db_xref="HSSP:1R9F"
FT                   /db_xref="InterPro:IPR004905"
FT                   /db_xref="UniProt/Swiss-Prot:P50625"
FT                   /product="19kDa protein"
FT                   /protein_id="CAA93126.1"
FT                   /translation="MERAIQGNDAREQAYGERWNGGPGGSTSPFQLPDESPSWTEWRLH
FT                   NDETNSNQDNPLGFKESWGFGKVVFKRYLRYERTETSLHRVLGSWTGDSVNYAASRFLG
FT                   FDQIGCTYSIRFRGVSVTISGGSRTLQHLSEMAIRSKQELLQLTPVKVESNVSRGRPEG
FT                   VETFKEESE"
XX
SQ   Sequence 876 BP; 242 A; 180 C; 239 G; 215 T; 0 other;

   Z68896  Length: 876  May 10, 2005 10:10  Type: N  Check: 3159  ..

       1  atggatactg aatacgagca agtcaataaa ccatggaacg agctatacaa
      51  ggaaacgacg ctagggaaca agcttatggt gaacgttgga atggaggacc
     101  aggaggttcc acttctccct tccaacttcc tgacgaaagt ccgagttgga
     151  ctgagtggcg gctacataac gatgagacga attcgaatca agataatccc
     201  cttggtttca aggaaagctg gggtttcggg aaagttgtat ttaagagata
     251  tctcagatac gaaaggacgg aaacttcact gcacagagtc cttggatctt
     301  ggacgggaga ttcggttaac tatgcagcat ctcgatttct cggtttcgac
     351  cagatcggat gtacctatag tattcggttt cgaggagtta gtgtcaccat
     401  ttctggaggg tcgcgaactc ttcagcatct cagtgaaatg gcaattcggt
     451  ctaagcaaga actgttacag cttaccccag tcaaagtgga aagtaatgta
     501  tcaagaggac gccctgaagg tgttgaaacc ttcaaagaag aaagcgagta
     551  agacaggctc ttcagtctga gttcgcggaa acgagtgtaa atctgcaacg
     601  catacaggtt acctccttgt tgggttctgg atcctatgat gacgagtcgg
     651  tcggctccgc actgggtttg gtcgcccagg ggatggagat atggaaaggg
     701  tctcgtgtgc tattagtcgg tcgaaagacg cgcttgcaac atgggcctat
     751  aaccggataa gtcatagcaa taccagccaa catgaattgg atgcctgttt
     801  acgggaatcg gatgtcactt gtggaaacgc acttggacac ggttgatctc
     851  acttcggggt ggctatagag atctct