Sequence of DPV Tomato bushy stunt virus

Tomato bushy stunt virus mRNA for 22kDa and 19kDa proteins (isolate B8).

ACC No: Z68897

Dated: 2005-04-18 | Length: 873 | CRC: -1581319484

                !!NA_SEQUENCE 1.0
ID   TBSVISOB8  standard; genomic RNA; VRL; 873 BP.
XX
AC   Z68897;
XX
SV   Z68897.1
XX
DT   26-JAN-1996 (Rel. 46, Created)
DT   18-APR-2005 (Rel. 83, Last updated, Version 7)
XX
DE   Tomato bushy stunt virus mRNA for 22kDa and 19kDa proteins (isolate B8).
XX
KW   19 kDa protein; 22 kDa protein.
XX
OS   Tomato bushy stunt virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Tombusvirus.
XX
RN   [2]
RP   1-873
RA   Fraile A.;
RT   ;
RL   Submitted (25-JAN-1996) to the EMBL/GenBank/DDBJ databases.
RL   Fraile A., E.T.S.Ingenieros Agronomos, Biotecnologia, Ciudad Universitaria,
RL   Madrid, Madrid, Spain, 28040
XX
RN   [3]
RP   1-873
RA   Luis-Areteaga M., Rodriguez-Cerezo E., Fraile A., Saez E.,
RA   Garcia-Arenal F.;
RT   "Different tomato bushy stunt virus strains cause disease outbreaks on
RT   solanaceous crops in Spain.";
RL   Phytopathology 86:535-542(1996).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .873
FT                   /db_xref="taxon:12145"
FT                   /mol_type="genomic RNA"
FT                   /organism="Tomato bushy stunt virus"
FT                   /isolate="TBSV-B8"
FT   CDS             1. .567
FT                   /db_xref="GOA:P50629"
FT                   /db_xref="InterPro:IPR005332"
FT                   /db_xref="UniProt/Swiss-Prot:P50629"
FT                   /product="22kDa protein"
FT                   /protein_id="CAA93127.1"
FT                   /translation="MDTEYEQVNKPWNELYQETTLGNQLMVNVGMEDPEVPLLPSNFLT
FT                   KVRVGLSGGYITMRRIRIKIIPLVSRKAGVSGKLYLRDISDTTGRKLHCTESLDLGREI
FT                   RLTMQHLDFSVSTRSDVPIVFGFEELVSPFLEGRELFSISVRWQFGLSKNCYSLPQSKW
FT                   KVMYQEDALNVKPSKKKASKTDSSV"
FT   CDS             33. .548
FT                   /db_xref="GOA:P50624"
FT                   /db_xref="HSSP:1R9F"
FT                   /db_xref="InterPro:IPR004905"
FT                   /db_xref="UniProt/Swiss-Prot:P50624"
FT                   /product="19kDa protein"
FT                   /protein_id="CAA93128.1"
FT                   /translation="MERAIPGNDTREPAYGERWNGGPGGSTSPFQLPDESPSWTEWRLH
FT                   YDETNSNQDNPLGFKESWGFGKVVFKRYLRYDGTETSLHRVLGSWTGDSVNYAASRFFG
FT                   FDQIGCTYSIRFRGVSVTISGGSRTLQHLSEMAIRSKQELLQLTPVQVESDVSRGRPEC
FT                   QTFKEESE"
XX
SQ   Sequence 873 BP; 238 A; 182 C; 241 G; 212 T; 0 other;

   Z68897  Length: 873  May 10, 2005 10:10  Type: N  Check: 2855  ..

       1  atggatactg aatacgaaca agtcaataaa ccatggaacg agctatacca
      51  ggaaacgaca ctagggaacc agcttatggt gaacgttgga atggaggacc
     101  cggaggttcc acttctccct tccaacttcc tgacgaaagt ccgagttgga
     151  ctgagtggcg gctacattac gatgagacga attcgaatca agataatccc
     201  cttggtttca aggaaagctg gggtttcggg aaagttgtat ttaagagata
     251  tctcagatac gacgggacgg aaacttcact gcacagagtc cttggatctt
     301  ggacgggaga ttcggttaac tatgcagcat ctcgattttt cggtttcgac
     351  cagatcggat gtacctatag tattcggttt cgaggagtta gtgtcaccat
     401  ttctggaggg tcgcgaactc ttcagcatct cagtgagatg gcaattcggt
     451  ctaagcaaga actgttacag cttaccccag tccaagtgga aagtgatgta
     501  tcaagaggac gccctgaatg tcaaaccttc aaagaagaaa gcgagtaaga
     551  cagactcttc agtctgagtg cgcggaaacg agtgtaaatc tggcaacgca
     601  tacaggttac tcttgttggg ttctggatgt tatgatgacg agtcggtcgg
     651  gctccgcact gggtttggtc gcctagggga tggagatatg gaaagggtcc
     701  tgtgtgctac atgctggcga aagacgcgct tgcaacatgg gcctataacc
     751  ggataagtca tagcaatacc agccaacatg aattggatgc ctgtttacgg
     801  gaaacggaat cacttgtgga aacgcacttg gacacggttg atcttcacct
     851  tcgggggggc tatagagatc gct