Sequence of DPV Tomato bushy stunt virus

Tomato bushy stunt virus mRNA for 22kDa and 19kDa proteins (isolate JA6).

ACC No: Z68901

Dated: 2005-04-18 | Length: 876 | CRC: -2060628163

                !!NA_SEQUENCE 1.0
ID   TBSVISJA6  standard; genomic RNA; VRL; 876 BP.
XX
AC   Z68901;
XX
SV   Z68901.1
XX
DT   26-JAN-1996 (Rel. 46, Created)
DT   18-APR-2005 (Rel. 83, Last updated, Version 7)
XX
DE   Tomato bushy stunt virus mRNA for 22kDa and 19kDa proteins (isolate JA6).
XX
KW   19 kDa protein; 22 kDa protein.
XX
OS   Tomato bushy stunt virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Tombusvirus.
XX
RN   [2]
RP   1-876
RA   Fraile A.;
RT   ;
RL   Submitted (25-JAN-1996) to the EMBL/GenBank/DDBJ databases.
RL   Fraile A., E.T.S.Ingenieros Agronomos, Biotecnologia, Ciudad Universitaria,
RL   Madrid, Madrid, Spain, 28040
XX
RN   [3]
RP   1-876
RA   Luis-Areteaga M., Rodriguez-Cerezo E., Fraile A., Saez E.,
RA   Garcia-Arenal F.;
RT   "Different tomato bushy stunt virus strains cause disease outbreaks on
RT   solanaceous crops in Spain.";
RL   Phytopathology 86:535-542(1996).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .876
FT                   /db_xref="taxon:12145"
FT                   /mol_type="genomic RNA"
FT                   /organism="Tomato bushy stunt virus"
FT                   /isolate="TBSV-JA6"
FT   CDS             1. .570
FT                   /db_xref="GOA:P50632"
FT                   /db_xref="InterPro:IPR005332"
FT                   /db_xref="UniProt/Swiss-Prot:P50632"
FT                   /product="22kDa protein"
FT                   /protein_id="CAA93135.1"
FT                   /translation="MDTEYEQVNKPWNELYKETTLGNKLTVNVGMEDQEVPLLPSNFLT
FT                   KVRVGLSGGYITMRRIRIKIIPLVSRKAGVSGKLYLRDISDTTGRKLHCTESLDLGREI
FT                   RLTMQHLDFSVSTRSDVPIVFGFEELVSPFLEGRELFSISVRWQFGLSKNCYSLPQSKW
FT                   KVMYQEDALKVLKPSKKKASKTDSSV"
FT   CDS             33. .551
FT                   /db_xref="GOA:P69516"
FT                   /db_xref="InterPro:IPR004905"
FT                   /db_xref="UniProt/Swiss-Prot:P69516"
FT                   /product="19kDa protein"
FT                   /protein_id="CAA93136.1"
FT                   /translation="MERAIQGNDAREQANSERWDGGSGGTTSPFKLPDESPSWTEWRLH
FT                   NDETNSNQDNPLGFKESWGFGKVVFKRYLRYDRTEASLHRVLGSWTGDSVNYAASRFFG
FT                   FDQIGCTYSIRFRGVSITVSGGSRTLQHLCEMAIRSKQELLQLAPIEVESNVSRGCPEG
FT                   TQTFEKEGE"
XX
SQ   Sequence 876 BP; 244 A; 174 C; 242 G; 216 T; 0 other;

   Z68901  Length: 876  May 10, 2005 10:10  Type: N  Check: 5469  ..

       1  atggatactg aatacgaaca agtcaataaa ccatggaacg agctatacaa
      51  ggaaacgacg ctagggaaca agctaacagt gaacgttggg atggaggatc
     101  aggaggtacc acttctccct tcaaacttcc tgacgaaagt ccgagttgga
     151  ctgagtggcg gctacataac gatgagacga attcgaatca agataatccc
     201  cttggtttca aggaaagctg gggtttcggg aaagttgtat ttaagagata
     251  tctcagatac gacaggacgg aagcttcact gcacagagtc cttggatctt
     301  ggacgggaga ttcggttaac tatgcagcat ctcgattttt cggtttcgac
     351  cagatcggat gtacctatag tattcggttt cgaggagtta gtatcaccgt
     401  ttctggaggg tcgcgaactc ttcagcatct ctgtgagatg gcaattcggt
     451  ctaagcaaga actgctacag cttgccccaa tcgaagtgga aagtaatgta
     501  tcaagaggat gccctgaagg tactcaaacc ttcgaaaaag aaggcgagta
     551  agacagactc ttcagtctga gtttgtggag atgagtgtaa atctggcata
     601  gcatacaggt tactcttgtt gggttctgga tgttaggatg acgagtcgac
     651  tcggctccgc actaggtttg gtcgcctagg ggatggagat atggaaaggg
     701  tctcgtgtgg tatcagtcgg tcgaaagacg cgcatccaac atgggcctat
     751  aaccggataa gtcttagcaa taccagccag catgaattgg attcctgttt
     801  acgaaagtta ggtgtcactt gtggaagcga acccagacac ggttgatctc
     851  acttcggggg ggctatagag atcgct