Sequence of DPV Melon necrotic spot virus

Melon necrotic spot virus gene for coat protein, complete cds.

ACC No: AB007001

Dated: 2007-09-20 | Length: 1173 | CRC: 953055978

                ID   AB007001; SV 1; linear; genomic RNA; STD; VRL; 1173 BP.
XX
AC   AB007001;
XX
DT   20-SEP-2007 (Rel. 93, Created)
DT   20-SEP-2007 (Rel. 93, Last updated, Version 1)
XX
DE   Melon necrotic spot virus gene for coat protein, complete cds.
XX
KW   .
XX
OS   Melon necrotic spot virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Carmovirus.
XX
RN   [1]
RP   1-1173
RA   Ohshima K.;
RT   ;
RL   Submitted (05-SEP-1997) to the EMBL/GenBank/DDBJ databases.
RL   Kazusato Ohshima, Saga University, Lab. Plant Virology, Faculty of
RL   Agriculture; 1-banchi, Honjo-machi, Saga, Saga 840-8502, Japan
RL   (E-mail:ohshimak@cc.saga-u.ac.jp, Tel:81-952-28-8730(ex.2730),
RL   Fax:81-952-28-8709)
XX
RN   [2]
RA   Matuo K., Ando T., Ohshima K., Sako N.;
RT   "Gene diagnosis of Melon necrotic spot virus strains in Japan";
RL   Unpublished.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1173
FT                   /organism="Melon necrotic spot virus"
FT                   /strain="NK"
FT                   /mol_type="genomic RNA"
FT                   /country="Japan"
FT                   /db_xref="taxon:11987"
FT   CDS             1. .1173
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /product="coat protein"
FT                   /protein_id="BAF80450.1"
FT                   /translation="MAMVKRINNLPTVKLAKQALPLLTNPKLVNKAIDVVPLVVQGGQK
FT                   LSKAAKRLLGAYGGNISYTEGAKPGAISAPVAISRRVAGMKPRFVRSEGSVKIVHREFI
FT                   ASVLPSNDLTVNNGDVNIGKYRVNPSNNALFTWLQGQAQLYDMYRFTRLRFTYIPTTGS
FT                   TSTGRVSILWDRDSQDPLPIDRAAISSYAHYADSAPWAENVLVVPCDNTWRYMNDTNAV
FT                   DRKLVDFGQFLFGTYSGAGATAHGDLYVEYAVEFKDPQPIAGMVCMFDRLVSFSEVGST
FT                   IKGVNYIADRDVITTGGNIGVNINIPGTYLVTIVLNVTSIGSLTFTGNSKLVGNSLNVT
FT                   SSGASALTFTLNSTGVPNSTNSSFSVGTVVALTRVRMTITRCSPETAYLA"
XX
SQ   Sequence 1173 BP; 273 A; 267 C; 271 G; 362 T; 0 other;

ab007001 Length: 1173  20-SEP-2007  Type: N  Check: 1347  ..

       1  atggcgatgg ttaaacgcat taataattta ccaacagtga agcttgctaa
      51  gcaggccttg cccctgctaa cgaatcctaa acttgtgaat aaggctatag
     101  atgtggttcc tttggtcgtc caaggtggtc agaaattgtc caaagctgcc
     151  aagcggttgc ttggcgctta tggtgggaat atttcttaca ctgagggcgc
     201  caagcctggt gcaatatccg ctccagttgc cattagtagg cgagtggcgg
     251  gtatgaagcc taggtttgtt cgatccgaag gatctgtgaa gatagttcat
     301  agggagttta ttgcctctgt tcttccgtcg aatgatctca ccgtgaataa
     351  tggtgatgtc aatatcggta agtatagggt caatcccagt aataacgctt
     401  tattcacatg gcttcaggga caagcgcaat tatatgatat gtacagattt
     451  actcgactac gatttaccta tattccaacc accggatcca cttccacagg
     501  tcgtgtttct attctctggg atagagactc ccaggatccc ctccctattg
     551  accgcgccgc tattagttct tatgctcatt acgctgattc agcgccttgg
     601  gcagagaacg tcttagtggt tccatgtgac aatacgtgga ggtacatgaa
     651  tgataccaat gcagtggacc ggaagttggt tgattttggg cagttccttt
     701  ttggtactta ttctggtgct ggtgccaccg cccacggtga tctctacgtt
     751  gagtatgctg ttgaattcaa agatccccag cctattgctg gaatggtttg
     801  tatgtttgat cgcttggtct ctttctctga agtcggatct acaattaaag
     851  gagtcaatta tattgctgat cgtgatgtga taaccactgg gggcaatatt
     901  ggtgttaaca tcaatattcc cgggacttat ctcgtcacga ttgttcttaa
     951  cgttacatca attggctccc ttactttcac tggtaattct aaactcgtag
    1001  gcaatagtct taacgtcacc agcagtggcg cttcagctct tacattcacc
    1051  cttaattcca ctggtgtgcc caacagtact aattcttcat tctctgtggg
    1101  caccgttgtt gcattgacta gggttcgtat gacgattact cgctgctctc
    1151  ctgaaaccgc ctacctcgcc tag