Sequence of DPV Melon necrotic spot virus

Melon necrotic spot virus gene for coat protein, complete cds.

ACC No: AB024525

Dated: 2005-04-14 | Length: 1173 | CRC: -645471994

                !!NA_SEQUENCE 1.0
ID   AB024525   standard; genomic RNA; VRL; 1173 BP.
XX
AC   AB024525;
XX
SV   AB024525.1
XX
DT   15-MAR-1999 (Rel. 59, Created)
DT   14-APR-2005 (Rel. 83, Last updated, Version 4)
XX
DE   Melon necrotic spot virus gene for coat protein, complete cds.
XX
KW   .
XX
OS   Melon necrotic spot virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Carmovirus.
XX
RN   [1]
RP   1-1173
RA   Sano T., Aota Y., Akada S.;
RT   ;
RL   Submitted (03-MAR-1999) to the EMBL/GenBank/DDBJ databases.
RL   Teruo Sano, Hirosaki University, Faculty of Agriculture and Life Science;
RL   Bunkyo-cho 3, Hirosaki, Aomori 036-8561, Japan
RL   (E-mail:sano@cc.hirosaki-u.ac.jp, Tel:81-172-39-3817, Fax:81-172-39-3816)
XX
RN   [2]
RA   Sano T., Aota Y., Akada S.;
RT   "Diagnosis and nucleotide sequence of melon necrotic spot virus (MNSV)
RT   occurring in Aomori prefecture";
RL   Hirosaki Daigaku Nogakubu gakujutsu hokoku 1:9-17(1999).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1173
FT                   /db_xref="taxon:11987"
FT                   /mol_type="genomic RNA"
FT                   /organism="Melon necrotic spot virus"
FT   CDS             1. .1173
FT                   /codon_start=1
FT                   /db_xref="GOA:Q9YLS5"
FT                   /db_xref="HSSP:2TBV"
FT                   /db_xref="InterPro:IPR000937"
FT                   /db_xref="UniProt/TrEMBL:Q9YLS5"
FT                   /product="coat protein"
FT                   /protein_id="BAA75897.1"
FT                   /translation="MAMVKRINNLPTVKLAKQALPLLTNPKIVNKAIDVVPLVVQGGQK
FT                   LSKAAKRLLGAYGGNISYTEGAKPGAISAPVAISRRVAGMKPRFVRSEGSVKIVHREFI
FT                   ASVLPSNDLTVNNGDVNIGKYRVNPSNNALFTWLQGQAQLYDMYRFTRLRFTYIPTTGS
FT                   TSTGRVSILWDRDSQDPLPIDRAAISSYAHYADSAPWAENVLVVPCDNTWRYMNDTNAV
FT                   DRKLVDFGQFLLATYSGAGATAHGDLYVEYAVEFKDPQPIAGMVCMFDRLVSFSEVGST
FT                   IKGVNYIADRDVITTGGNIGVNINIPGTYLVTIVFNATSIGSLTFTGNSKLVGNSLNVT
FT                   SSGASALTFTLNSTGVPNSTNSSFSVGTVVALTRVRMTITRCSPETAYLA"
XX
SQ   Sequence 1173 BP; 271 A; 271 C; 271 G; 360 T; 0 other;

 AB024525  Length: 1173  April 19, 2005 08:50  Type: N  Check: 1810  ..

       1  atggcgatgg ttaaacgcat taataattta ccgacagtga agcttgctaa
      51  gcaggcattg cccctgctaa cgaatcctaa aattgtgaat aaggctatag
     101  atgtggttcc tttggtcgtc caaggtggtc agaaattgtc caaagctgcc
     151  aagcggttgc ttggtgctta tggtggtaat atttcttaca ctgagggcgc
     201  taagcctggt gcaatatccg ctccagttgc cattagtagg cgagtggcgg
     251  gtatgaagcc taggtttgtt cggtccgaag gatctgtgaa gatagttcat
     301  agggagttta ttgcctctgt tcttccgtcg aatgatctca ccgtgaataa
     351  tggtgatgtc aatatcggta agtatagggt caatcccagt aataatgctt
     401  tattcacatg gcttcaggga caagcgcaat tgtatgatat gtacagattt
     451  actcgacttc gatttaccta tattccaacc accggatcca cttccacagg
     501  tcgtgtttct attctctggg atagagactc tcaggatccc ctccctattg
     551  accgcgccgc cattagttct tatgctcatt acgctgattc agcgccttgg
     601  gcagagaacg ttttagtggt cccgtgtgac aatacgtgga ggtatatgaa
     651  tgataccaat gcagtggacc ggaagttggt tgattttggg cagttcctcc
     701  ttgctactta ttctggtgct ggtgccaccg cccacggtga tctctacgtt
     751  gagtacgctg ttgaattcaa agatccccag cctattgctg gaatggtttg
     801  tatgtttgat cgcttggtct ctttctctga agtcggatct acaattaaag
     851  gagtcaatta cattgctgat cgcgatgtga taaccactgg aggcaatatt
     901  ggtgttaata tcaatattcc agggacttat ctcgtcacga ttgtttttaa
     951  cgccacttca attggctccc ttaccttcac tggcaattct aaactcgtag
    1001  gcaatagtct taacgttacc agcagcggcg cttcagctct cacattcacc
    1051  ctcaattcca ctggtgtgcc caacagtacc aattcttcat tctctgtggg
    1101  caccgtcgtt gctttgacta gggttcgtat gacgattact cgctgctctc
    1151  ctgaaactgc ctacctcgcc taa