Sequence of DPV Melon necrotic spot virus

Melon necrotic spot virus genes for p29, p89, p7A, p7B, p14, p42 coat protein, complete cds, isolate:NH.

ACC No: AB044291

Dated: 2005-04-14 | Length: 3992 | CRC: 1555948658

                !!NA_SEQUENCE 1.0
ID   AB044291   standard; genomic RNA; VRL; 3992 BP.
XX
AC   AB044291;
XX
SV   AB044291.2
XX
DT   10-JAN-2002 (Rel. 70, Created)
DT   14-APR-2005 (Rel. 83, Last updated, Version 4)
XX
DE   Melon necrotic spot virus genes for p29, p89, p7A, p7B, p14, p42 coat
DE   protein, complete cds, isolate:NH.
XX
KW   .
XX
OS   Melon necrotic spot virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Carmovirus.
XX
RN   [1]
RP   1-3992
RA   Ohshima K.;
RT   ;
RL   Submitted (05-JUN-2000) to the EMBL/GenBank/DDBJ databases.
RL   Kazusato Ohshima, Saga University, Faculty of Agriculture, Laboratory of
RL   Plant Virology; 1-banchi,Honjo-machi, Saga, Saga, 840-8502, Japan
RL   (E-mail:Ohshimak@cc.saga-u.ac.jp, Tel:0952-28-8730, Fax:0952-28-8709)
XX
RN   [2]
RA   Ohshima K., Ando T., Motomura N., Matsuo K., Sako N.;
RT   "Nucleotide sequences of protein genes of two Japanese melon necrotic spot
RT   virus isolates";
RL   Unpublished.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .3992
FT                   /country="Japan"
FT                   /db_xref="taxon:11987"
FT                   /mol_type="genomic RNA"
FT                   /organism="Melon necrotic spot virus"
FT                   /isolate="NH"
FT   CDS             93. .2468
FT                   /codon_start=1
FT                   /db_xref="GOA:Q8V996"
FT                   /db_xref="InterPro:IPR002166"
FT                   /db_xref="InterPro:IPR007094"
FT                   /db_xref="InterPro:IPR007095"
FT                   /db_xref="UniProt/TrEMBL:Q8V996"
FT                   /note="The readthrough amino acid has not been identified"
FT                   /note="readthrough product"
FT                   /transl_except=(pos:897. .899,aa:OTHER)
FT                   /product="p89"
FT                   /protein_id="BAB82507.1"
FT                   /translation="MDTGLKFLVSGGLATSSVIRKVSAVSSLDSSLPSSSILSAIHGSW
FT                   TSAISHDCSKIAKVATVIGIGYLGVRIGAAWCRRAPGITNSIITYGEEVVEQVKVDIDE
FT                   EAEEESDTGEEIVVGTIGIGIHTNVNPEVRAKRRHRSRPFIKKIVNLTKNHFGGCPDSS
FT                   KSNVMAVSKFVYEQCKQHNCLPHQTRLIMSVAVPLVLSPDMYDISSKALLNSEILTENR
FT                   ATLDRLKTLDGWLSHLVCHPLSTKAWRRAIDNLCGLPDWKAFKLVNXGCLEELAGFCTS
FT                   VRRGTHPDMTEFPQDRPIKTRKLYCLGGVGTSVKFNVHNNSLANLRRGLIERVFFVEND
FT                   KKELEPAPKPLSGVFDRLTWFRRKLHNIVGTHSSISPGKSLDFYTGRRRTIYEGAVKSL
FT                   EGLSVQRRDAYLKTFVKAEKINTTKKPDPAPRVIQPRNVRYNVEVGRYLRRFEHYLYRG
FT                   IDEIWNGPTIIKGYTVEQIGKIARDAWDSFVSPVAIGFDMKRVRPHVSSDALKWEHSVY
FT                   LDALGHDSYLAELLEWQLVNKGVGYASDGMIKYKVDGCRMSGDMNTAMGNCLIACAITH
FT                   DFFRSRGIRARLMNNGDDCVVICEKECAAVVKADMVRHWRQFGFQCELECDAEVFEQIE
FT                   FCQMRPVYDGEKYVMVRNPLVSLSKDSYSVGPWNGVNHARKWVNAVGLCGLSLTGGIPV
FT                   VQSYYNMMIRNTQSVNSSGILRDVSFASGFRELARLGNRKSGAISEDARFSFYLAFGIT
FT                   PDLQRAMESDYDAHTIEWGFVPQGNPRIQPISWTLNEL"
FT   CDS             93. .899
FT                   /codon_start=1
FT                   /db_xref="UniProt/TrEMBL:Q8V995"
FT                   /product="p29"
FT                   /protein_id="BAB82508.1"
FT                   /translation="MDTGLKFLVSGGLATSSVIRKVSAVSSLDSSLPSSSILSAIHGSW
FT                   TSAISHDCSKIAKVATVIGIGYLGVRIGAAWCRRAPGITNSIITYGEEVVEQVKVDIDE
FT                   EAEEESDTGEEIVVGTIGIGIHTNVNPEVRAKRRHRSRPFIKKIVNLTKNHFGGCPDSS
FT                   KSNVMAVSKFVYEQCKQHNCLPHQTRLIMSVAVPLVLSPDMYDISSKALLNSEILTENR
FT                   ATLDRLKTLDGWLSHLVCHPLSTKAWRRAIDNLCGLPDWKAFKLVN"
FT   CDS             2447. .2833
FT                   /codon_start=1
FT                   /db_xref="GOA:Q8V994"
FT                   /db_xref="InterPro:IPR007982"
FT                   /db_xref="InterPro:IPR009575"
FT                   /db_xref="UniProt/TrEMBL:Q8V994"
FT                   /note="The readthrough amino acid has not been identified"
FT                   /note="readthrough product"
FT                   /transl_except=(pos:2642. .2644,aa:OTHER)
FT                   /product="p14"
FT                   /protein_id="BAB82509.1"
FT                   /translation="MDSQRTVEQTNPRGRSKERGDSGGKQKNSMGRKIANDAISESKQG
FT                   VMGASTYIADKIKVTINFNFXCMACYRCDSSPGDYSGALLILFISFVFFYITSLSPQGN
FT                   TYVHHFDNSSVKTQYVGISTNGDG"
FT   CDS             2447. .2644
FT                   /codon_start=1
FT                   /db_xref="GOA:Q8V993"
FT                   /db_xref="InterPro:IPR007982"
FT                   /db_xref="UniProt/TrEMBL:Q8V993"
FT                   /product="p7A"
FT                   /protein_id="BAB82510.1"
FT                   /translation="MDSQRTVEQTNPRGRSKERGDSGGKQKNSMGRKIANDAISESKQG
FT                   VMGASTYIADKIKVTINFNF"
FT   CDS             2648. .2833
FT                   /codon_start=1
FT                   /db_xref="InterPro:IPR009575"
FT                   /db_xref="UniProt/TrEMBL:Q8UYH9"
FT                   /product="p7B"
FT                   /protein_id="BAB82511.1"
FT                   /translation="MACYRCDSSPGDYSGALLILFISFVFFYITSLSPQGNTYVHHFDN
FT                   SSVKTQYVGISTNGDG"
FT   CDS             2820. .3992
FT                   /codon_start=1
FT                   /db_xref="GOA:Q83427"
FT                   /db_xref="HSSP:2TBV"
FT                   /db_xref="InterPro:IPR000937"
FT                   /db_xref="UniProt/TrEMBL:Q83427"
FT                   /product="p42 coat protein"
FT                   /protein_id="BAB82512.1"
FT                   /translation="MAMVKRINNLPTVKLAKQALPLLTNPKIVNKAIDVVPLVVQGGQK
FT                   LSKAAKRLLGAYGGNISYTEGARPGAISAPVAISRRVAGMKPRFVRSEGSVKIVHREFI
FT                   ASVLPSNDLTVNNGDVNIGKYRVNPSNNALFTWLQGQAQLYDMYRFTRLRFTYIPTTGS
FT                   TSTGRVSILWDRDSQDPLPIDRAAISSYAHYADSTPWAENVLVVPCDNTWRYMNDTNAV
FT                   DRKLVDFGQFLFATYSGAGATAHGDLYVEYAVEFKDPQPIAGMVCMFDRLVSFSEVGST
FT                   IKGVNYIADRDVITTGGNISVNINIPGTYLVTIVLNATSIGSLTFTGNSKLVGNSLNVT
FT                   SSGASALTFTLNSTGVPNSTNSSFSVGTVVALTRVRMTITRCSPETAYLA"
XX
SQ   Sequence 3992 BP; 1025 A; 823 C; 989 G; 1155 T; 0 other;

 AB044291  Length: 3992  April 19, 2005 08:56  Type: N  Check: 4023  ..

       1  tttgttcttt ccacggatcc ccgacttctt cggttttgac agttagttag
      51  ttcgtatata aggttatcca tcttaatcaa tacaggttag caatggatac
     101  tggtttgaaa tttcttgttt ctggaggttt agccacctca tctgttatta
     151  ggaaagtgag tgctgtgagt tcattggatt cgtcccttcc ttcatcgtct
     201  atactatctg ccattcatgg gtcttggact agtgctatca gccacgattg
     251  tagcaagatt gccaaggttg ccaccgtgat tggaattggt tatcttgggg
     301  ttcgaattgg tgccgcatgg tgtcgtcgtg cccccggaat aacgaattct
     351  ataattacat acggggaaga agtggttgag caagtaaagg tggatattga
     401  tgaagaagct gaagaggagt ccgatactgg tgaggaaatt gtggttggca
     451  cgataggtat tggtatacac actaacgtca accctgaggt tcgagctaag
     501  cgcagacata gatcgaggcc attcattaag aagattgtga atttaacgaa
     551  aaatcacttt ggtggatgcc ccgattcaag taaatcgaac gtcatggctg
     601  ttagcaagtt tgtttatgaa caatgtaaac agcacaattg tcttccacat
     651  cagacgagat tgatcatgag tgttgcagtt ccattggtgt taagtcccga
     701  catgtacgat atttccagta aagctctgtt aaacagcgag atattgacag
     751  aaaacagagc tacactggac cgcctcaaaa ctcttgacgg gtggctgtca
     801  catttagtgt gccaccccct tagcacgaag gcttggaggc gggcgattga
     851  caacttatgt ggtcttcctg attggaaggc cttcaagttg gtcaactagg
     901  ggtgcctaga ggaactcgct gggttctgta cttcggtacg gagggggacg
     951  cacccagaca tgaccgagtt tcctcaggat cgtcccatta agacacgcaa
    1001  actgtattgt ttggggggag ttggaactag cgtgaagttc aatgtacaca
    1051  ataactctct agctaacctt cggcgcggtc ttatagaacg cgttttcttt
    1101  gttgaaaatg ataagaagga actagagcct gcccctaaac cccttagtgg
    1151  tgtgtttgac cgcttaacct ggtttcgtcg gaaactccat aacattgtgg
    1201  gtactcattc cagtattagt ccaggtaaat ccttggattt ctatactggc
    1251  aggaggcgta caatctatga gggtgccgtg aagtcattgg aggggttaag
    1301  tgttcaaaga agggatgcct atttgaaaac gtttgttaag gcggagaaga
    1351  ttaacaccac taagaagcct gacccagctc cgcgggtcat acaaccgagg
    1401  aacgtaagat acaatgttga ggttggtcgt tatctacgta ggtttgagca
    1451  ttacctctat cgaggaattg atgaaatctg gaatggcccc actataatta
    1501  aaggatacac tgtcgagcaa attgggaaaa tcgctcgtga tgcttgggac
    1551  tctttcgtga gccccgtggc aatcgggttt gatatgaaga gggtccgacc
    1601  acatgtatcc tccgacgctc ttaaatggga acacagtgtt tatcttgatg
    1651  ctttgggcca tgattcttat cttgcagaat tgttggagtg gcaattagtc
    1701  aataaaggag tcgggtatgc cagtgacgga atgatcaaat ataaggttga
    1751  tgggtgccgg atgagtggtg acatgaatac agctatgggt aactgtctga
    1801  ttgcctgtgc tatcacacat gatttcttcc gtagtcgtgg tatcagggcg
    1851  cgtttgatga acaatggtga tgactgtgtc gtaatatgtg aaaaagaatg
    1901  tgccgcggtg gttaaagccg acatggtaag gcactggaga caattcgggt
    1951  ttcaatgcga gctcgaatgc gacgcagaag tcttcgagca aattgagttt
    2001  tgtcaaatgc gacctgtgta cgacggggaa aaatatgtga tggtgcggaa
    2051  tccgctagtt agcctgtcta aagattcata ctcagtcggc ccatggaatg
    2101  gagtcaacca tgcacgcaag tgggtaaatg ccgtaggctt gtgtggctta
    2151  tccctcactg gtggaattcc tgttgtccag agttactata atatgatgat
    2201  tcgtaacact caatccgtga acagttctgg cattctccgg gatgtcagtt
    2251  ttgctagtgg atttcgggag ttagcgcgat tgggtaacag gaaaagtggt
    2301  gccatatcag aagacgcccg ttttagcttt tatctcgcat ttggcattac
    2351  tccagattta caacgtgcca tggaaagtga ctatgatgct cataccatag
    2401  agtggggttt cgtgccccag ggaaatccta gaatacagcc aatctcatgg
    2451  actctcaacg aactgtagaa caaactaatc ctcggggaag aagtaaagaa
    2501  cgtggtgaca gcgggggaaa acagaagaac tcaatggggc gaaagatagc
    2551  caatgatgct atctctgaat cgaagcaggg agttatgggt gctagcacat
    2601  atattgctga taaaattaag gtgactatca actttaattt ttagtgtatg
    2651  gcttgttacc gttgtgactc cagccccggg gattactctg gagctttgct
    2701  tatattattt atctcatttg ttttcttcta tattacctcg cttagcccgc
    2751  aaggaaatac ttacgttcac cacttcgata attcttccgt taaaacgcaa
    2801  tacgttggca tctctacaaa tggcgatggt taaacgcatt aataatttac
    2851  caacagtgaa gcttgctaag caggccttgc ccctgttaac gaatcctaaa
    2901  attgtgaata aggctataga tgtggttcct ttggtcgtcc aaggtggtca
    2951  gaaattgtcc aaagctgcca agcggctgct tggcgcttat ggtggtaata
    3001  tttcttacac tgagggtgct agacctggtg caatatccgc tccagttgcc
    3051  attagtaggc gagtggcggg tatgaagcct aggtttgttc gatccgaagg
    3101  atcagtgaag atagttcata gggagttcat tgcctctgtt cttccgtcaa
    3151  atgatctcac cgtgaacaat ggtgatgtca atatcggtaa gtatagggtc
    3201  aatcccagta ataacgcttt attcacatgg cttcagggac aagcgcaatt
    3251  atatgatatg tacagattta ctcgactacg atttacctat attccaacca
    3301  ccggatccac ttctacaggt cgtgtttcta ttctttggga tagagactct
    3351  caggatcccc tccctattga ccgcgccgct attagttctt atgctcatta
    3401  cgctgattca acgccttggg cagagaacgt tttagtggtt ccgtgtgaca
    3451  atacgtggag gtacatgaat gataccaacg cagtggaccg gaagttggtt
    3501  gattttgggc agttcctctt tgctacctat tctggtgctg gtgccaccgc
    3551  ccacggtgat ctctacgttg agtatgctgt ggaattcaaa gatccccagc
    3601  ctattgctgg aatggtttgt atgtttgatc gcttggtctc tttctctgaa
    3651  gtcggatcca caattaaagg agtcaattat attgctgatc gtgatgtgat
    3701  aaccactggg ggcaatatta gtgtcaacat caatattccc gggacttatc
    3751  tcgttacgat tgttcttaac gctacatcaa ttggctccct taccttcact
    3801  ggtaattcta aactcgtagg caatagtctt aacgtcacca gcagtggcgc
    3851  ttcagctctt acattcaccc ttaattccac tggtgtgccc aacagtacta
    3901  attcttcatt ttccgtgggc accgttgttg cattgaccag ggttcgtatg
    3951  acgattactc gctgctctcc tgaaaccgcc tacctcgcct ag