Sequence of DPV Melon necrotic spot virus

Melon necrotic spot virus genes for p29, p89, p7A, p7B, p14, p42 coat protein, complete cds, isolate:NK.

ACC No: AB044292

Dated: 2005-04-14 | Length: 4046 | CRC: 479389461

                !!NA_SEQUENCE 1.0
ID   AB044292   standard; genomic RNA; VRL; 4046 BP.
XX
AC   AB044292;
XX
SV   AB044292.2
XX
DT   10-JAN-2002 (Rel. 70, Created)
DT   14-APR-2005 (Rel. 83, Last updated, Version 4)
XX
DE   Melon necrotic spot virus genes for p29, p89, p7A, p7B, p14, p42 coat
DE   protein, complete cds, isolate:NK.
XX
KW   .
XX
OS   Melon necrotic spot virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Carmovirus.
XX
RN   [1]
RP   1-4046
RA   Ohshima K.;
RT   ;
RL   Submitted (05-JUN-2000) to the EMBL/GenBank/DDBJ databases.
RL   Kazusato Ohshima, Saga University, Faculty of Agriculture, Laboratory of
RL   Plant Virology; 1-banchi,Honjo-machi, Saga, Saga, 840-8502, Japan
RL   (E-mail:Ohshimak@cc.saga-u.ac.jp, Tel:0952-28-8730, Fax:0952-28-8709)
XX
RN   [2]
RA   Ohshima K., Ando T., Motomura N., Matsuo K., Sako N.;
RT   "Nucleotide sequences of protein genes of two Japanese melon necrotic spot
RT   virus isolates";
RL   Unpublished.
XX
RN   [3]
RA   Ohshima K., Tsuyu A., Motomura N., Matsuo K., Sako N.;
RT   "Nucleotide sequences of protein genes of two Japanese melon necrotic spot
RT   virus isolates";
RL   Unpublished.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .4046
FT                   /country="Japan"
FT                   /db_xref="taxon:11987"
FT                   /mol_type="genomic RNA"
FT                   /organism="Melon necrotic spot virus"
FT                   /isolate="NK"
FT   CDS             93. .2468
FT                   /codon_start=1
FT                   /db_xref="GOA:Q8V992"
FT                   /db_xref="InterPro:IPR002166"
FT                   /db_xref="InterPro:IPR007094"
FT                   /db_xref="InterPro:IPR007095"
FT                   /db_xref="UniProt/TrEMBL:Q8V992"
FT                   /note="The readthrough amino acid has not been identified"
FT                   /note="readthrough product"
FT                   /transl_except=(pos:897. .899,aa:OTHER)
FT                   /product="p89"
FT                   /protein_id="BAB82513.1"
FT                   /translation="MDTGLKFLVSGGLATSSVIRKVSAVSSLDSSLPSSSILSAIHGSW
FT                   TSAISHDCSKIAKVATVIGIGYLGVRIGAAWCRRTPGITNSIITYGEEVVEQVKVDIDE
FT                   DAEEESDTGEEIVVGTIGIGIHTNVNPEVRAKRRHRSRPFIKKIVNLTKNHFGGCPDSS
FT                   KSNVMAVSKFVYEQCKQHNCLPHQTRLIMSVAVPLVFNPDMYDISSKALLNSEILTENR
FT                   ATLDRLKTLDGWLSHLVCHPLSTKAWRRAIDNLCGLPDWKAFKLVNXGCLEELAGFCTS
FT                   VRRGTHPDMTEFPQDRPIKTRKLYCLGGVGTSVKFNVHNNSLANLRRGLIERVFFVEND
FT                   KKDLEPAPKPLSGVFDRLTWFRRKLHNIVGTHSSISPGQFLDFYTGRRRTIYEGAVKSL
FT                   EGLSVQRRDAYLKTFVKAEKINTTRKPDPAPRVIQPRNVRYNVEVGRYLRRFEHYLYRR
FT                   IDEIWNGPTIIKGYTVEQIGKIARDAWDSFVSPVAIGFDMKRFDQHVSSDALKWEHSVY
FT                   LDAFCHDSYLAELLEWQLVNKGVGYASDGMIKYKVDGCRMSGDMNTAMGNCLIACAITH
FT                   DFFRSPGIRARLMNNGDDCVVICEKECAAVVKADMVRHWRQFGFQCELECDAEVFEQIE
FT                   FCQMRPVYDGEKYVMVRNPLVSLSKDSYSVGPWNGVNHARKWVNAVGLCGLSLTGGIPV
FT                   VQSYYNMMIRNTQSVNSSGILRDVSFASGFRELARLGNRKNGAISEDARFSFYLAFGIT
FT                   PDLQRAMESDYDAHTIEWGFVPQGNPRIQPISWTLNEL"
FT   CDS             93. .899
FT                   /codon_start=1
FT                   /db_xref="UniProt/TrEMBL:Q8V991"
FT                   /product="p29"
FT                   /protein_id="BAB82514.1"
FT                   /translation="MDTGLKFLVSGGLATSSVIRKVSAVSSLDSSLPSSSILSAIHGSW
FT                   TSAISHDCSKIAKVATVIGIGYLGVRIGAAWCRRTPGITNSIITYGEEVVEQVKVDIDE
FT                   DAEEESDTGEEIVVGTIGIGIHTNVNPEVRAKRRHRSRPFIKKIVNLTKNHFGGCPDSS
FT                   KSNVMAVSKFVYEQCKQHNCLPHQTRLIMSVAVPLVFNPDMYDISSKALLNSEILTENR
FT                   ATLDRLKTLDGWLSHLVCHPLSTKAWRRAIDNLCGLPDWKAFKLVN"
FT   CDS             2447. .2833
FT                   /codon_start=1
FT                   /db_xref="GOA:Q8V990"
FT                   /db_xref="InterPro:IPR007982"
FT                   /db_xref="InterPro:IPR009575"
FT                   /db_xref="UniProt/TrEMBL:Q8V990"
FT                   /note="The readthrough amino acid has not been identified"
FT                   /note="readthrough product"
FT                   /transl_except=(pos:2642. .2644,aa:OTHER)
FT                   /product="p14"
FT                   /protein_id="BAB82515.1"
FT                   /translation="MDSQRTVEQTNPRGRIKERGDSGGKQKNSMGRKIANDAISESKQG
FT                   VMGASTYIADKIKVTINFNFXCMACYRCDSSPGDYSGALLILFISFVFFYITSLSPQGN
FT                   TYVHHFDNSSVKTQYVGISTNGDG"
FT   CDS             2447. .2644
FT                   /codon_start=1
FT                   /db_xref="GOA:Q8V989"
FT                   /db_xref="InterPro:IPR007982"
FT                   /db_xref="UniProt/TrEMBL:Q8V989"
FT                   /product="p7A"
FT                   /protein_id="BAB82516.1"
FT                   /translation="MDSQRTVEQTNPRGRIKERGDSGGKQKNSMGRKIANDAISESKQG
FT                   VMGASTYIADKIKVTINFNF"
FT   CDS             2648. .2833
FT                   /codon_start=1
FT                   /db_xref="InterPro:IPR009575"
FT                   /db_xref="UniProt/TrEMBL:Q8UYH9"
FT                   /product="p7B"
FT                   /protein_id="BAB82517.1"
FT                   /translation="MACYRCDSSPGDYSGALLILFISFVFFYITSLSPQGNTYVHHFDN
FT                   SSVKTQYVGISTNGDG"
FT   CDS             2820. .3992
FT                   /codon_start=1
FT                   /db_xref="GOA:Q8V988"
FT                   /db_xref="HSSP:2TBV"
FT                   /db_xref="InterPro:IPR000937"
FT                   /db_xref="UniProt/TrEMBL:Q8V988"
FT                   /product="p42 coat protein"
FT                   /protein_id="BAB82518.1"
FT                   /translation="MAMVKRINNLPTVKLAKQALPLLTNPKLVNKAIDVVPLVVQGGQK
FT                   LSKAAKRLLGAYGGNISYTEGAKPGAISAPVAISRRVAGMKPRFVRSEGSVKIVHREFI
FT                   ASVLPSNDLTVNNGDVNIGKYRVNPSNNALFTWLQGQAQLYDMYRFTRLRFTYIPTTGS
FT                   TSTGRVSILWDRDSQDPLPIDRAAISSYAHYADSAPWAENVLVVPCDNTWRYMNDTNAV
FT                   DRKLVDFGQFLFATYSGAGATAHGDLYVEYAVEFKDPQPIAGMVCMFDRLVSFSEVGST
FT                   IKGVNYIADRDVITTGGNIGVNINIPGTYLVTIVLNVTSIGSLTFTGNSKLVGNSLNVT
FT                   SSGASALTFTLNSTGVPNSTNSSFSVGTVVALTRVRMTITRCSPETAYLA"
XX
SQ   Sequence 4046 BP; 1030 A; 842 C; 988 G; 1186 T; 0 other;

 AB044292  Length: 4046  April 19, 2005 08:53  Type: N  Check: 3778  ..

       1  tttgttcttt ccacggatcc ccgacttctt cggttttgac agttagttag
      51  ttcgtatata aggttatctc tcttaatcaa tacaggttag caatggatac
     101  tggtttgaaa tttcttgttt ctggaggttt agccacctca tctgttatta
     151  ggaaagtgag tgctgtgagt tcattggatt cgtcccttcc ttcatcgtct
     201  atactatctg ccattcatgg gtcttggact agtgctatca gccacgattg
     251  tagcaagatt gccaaggttg ccaccgtgat tggaattggt tatcttgggg
     301  ttcggattgg tgccgcatgg tgtcgtcgta cccccgggat aacgaattct
     351  ataattacat acggggaaga agtggttgag caagtaaagg tggatattga
     401  tgaagatgct gaagaggagt ccgatactgg tgaggaaatt gtggttggca
     451  cgataggtat tggcatacac actaacgtca accctgaggt tcgagctaag
     501  cgcagacata gatcgaggcc attcattaag aagattgtga atttaacgaa
     551  aaatcacttt ggtggatgtc ccgattcaag taaatcgaac gtcatggctg
     601  ttagcaaatt tgtttatgaa caatgtaaac agcacaattg tcttccacat
     651  cagacaagat tgatcatgag tgttgcggtt ccattggtgt ttaatcccga
     701  catgtacgac atttccagta aagctctgtt aaacagcgag atattgacag
     751  aaaacagagc tacgctggac cgcctcaaaa ctcttgacgg gtggctgtca
     801  catttagtgt gccaccccct cagcacgaag gcttggaggc gggcgattga
     851  caacttgtgt ggtcttcctg attggaaggc cttcaagttg gtcaactagg
     901  ggtgcctaga ggaactcgct gggttctgta cttcggtacg gagggggacg
     951  cacccagaca tgaccgagtt tcctcaggat cgtcccatta agacacgcaa
    1001  actgtattgt ttggggggag ttggaactag cgttaagttc aatgtacaca
    1051  ataactctct agctaacctt cggcgcggtc ttatagaacg cgttttcttt
    1101  gttgaaaatg ataagaagga cctagagcct gcccccaaac cccttagtgg
    1151  tgtgtttgac cgcttaacct ggtttcgtcg gaaactccat aacattgtgg
    1201  gtactcattc cagtattagt ccaggtcaat tcttggattt ctatactggc
    1251  aggaggcgta caatttatga aggtgccgtg aagtcattgg aggggttaag
    1301  tgttcaaaga agggatgcct atttgaaaac gtttgttaag gcggagaaga
    1351  ttaacaccac taggaagcct gacccagctc cgcgggtcat acaaccgagg
    1401  aacgtaagat ataatgttga agttggtcgt tatctacgta ggtttgagca
    1451  ttacctctat cgaagaattg atgaaatctg gaatggcccc actataatta
    1501  aaggatacac tgtcgagcaa attgggaaaa ttgctcgtga tgcttgggac
    1551  tctttcgtga gccccgtggc aatcgggttt gatatgaaga ggttcgacca
    1601  acatgtatcc tccgacgctc ttaaatggga acacagtgtt taccttgatg
    1651  ctttttgcca tgattcttat cttgcagaat tgttggagtg gcaattagtc
    1701  aataaaggag tcgggtatgc cagtgatgga atgatcaaat ataaggttga
    1751  tgggtgccgg atgagtggtg acatgaatac agctatgggt aactgtctga
    1801  ttgcctgtgc tatcacacat gatttcttcc gtagtcctgg tatcagggcg
    1851  cgtttgatga acaatggtga tgactgtgtc gtaatatgtg aaaaagaatg
    1901  tgccgcggtg gttaaagccg acatggtaag gcactggaga caattcgggt
    1951  ttcaatgcga gctcgagtgc gacgcagaag tcttcgagca aattgagttt
    2001  tgtcaaatgc ggcctgtgta cgacggggaa aaatatgtga tggtgcggaa
    2051  tccgctagtt agcctatcta aagattcata ctcagtcggc ccatggaatg
    2101  gagtcaacca tgcacgcaag tgggtaaacg ctgtaggctt gtgtggctta
    2151  tccctcactg gtggaattcc tgttgtccag agttactata atatgatgat
    2201  tcgtaacact caatccgtga acagttctgg cattctccgg gatgtcagtt
    2251  ttgctagtgg atttcgggag ttagcgcgat tgggtaacag gaaaaatggt
    2301  gccatatcag aagacgcccg ttttagcttt tatctcgcat ttggcattac
    2351  tccagattta caacgtgcca tggaaagtga ctatgatgct cataccatag
    2401  agtggggttt cgtgccccag ggaaatccta gaatacagcc aatctcatgg
    2451  actctcaacg aactgtagaa caaactaatc ctcggggaag aattaaagaa
    2501  cgtggtgaca gcgggggaaa acagaagaac tcaatggggc gaaagatagc
    2551  caatgatgct atctctgaat cgaagcaggg agttatgggt gctagcacat
    2601  acattgctga caaaattaag gtgactatca actttaattt ttagtgtatg
    2651  gcttgttacc gttgtgactc cagccccggg gattactctg gagctttgct
    2701  tatattattt atctcatttg ttttcttcta cattacctcg cttagcccgc
    2751  aaggaaatac ttacgttcac cacttcgata attcttccgt taaaacgcaa
    2801  tacgttggca tctctacaaa tggcgatggt taaacgcatt aataatttac
    2851  caacagtgaa gcttgctaag caggccctgc ccctgctaac gaatcctaaa
    2901  cttgtgaata aggctataga tgtggttcct ttggtcgtcc aaggtggtca
    2951  gaaattgtcc aaagctgcca agcggttgct tggcgcttat ggtggtaata
    3001  tttcttacac tgagggcgcc aagcctggtg caatatccgc tccagttgcc
    3051  attagtaggc gagtggcggg tatgaagcct aggtttgttc gatccgaagg
    3101  atctgtgaag atagttcata gggagtttat tgcctctgtt cttccgtcga
    3151  atgatctcac cgtgaataat ggtgatgtca atatcggtaa gtatagggtc
    3201  aatcccagta ataacgcttt attcacatgg cttcagggac aagcgcaatt
    3251  atatgatatg tacagattta ctcgactacg atttacctat attccaacca
    3301  ccggatccac ttccacaggt cgtgtttcta ttctctggga tagagactcc
    3351  caggatcccc tccctattga ccgcgccgct attagttctt atgctcatta
    3401  cgctgattca gcgccttggg cagagaacgt cttagtggtt ccatgtgaca
    3451  atacgtggag gtacatgaat gataccaatg cagtggaccg gaagttggtt
    3501  gattttgggc agttcctttt tgctacttat tctggtgctg gtgccaccgc
    3551  ccacggtgat ctctacgttg agtatgctgt tgaattcaaa gatccccagc
    3601  ctattgctgg aatggtttgt atgtttgatc gcttggtctc tttctctgaa
    3651  gtcggatcta caattaaagg agtcaattat attgctgatc gtgatgtgat
    3701  aaccactggg ggcaatattg gtgttaacat caatattccc gggacttatc
    3751  tcgtcacgat tgttcttaac gttacatcaa ttggctccct tactttcact
    3801  ggtaattcta aactcgtagg caatagtctt aacgtcacca gcagtggcgc
    3851  ttcagctctt acattcaccc ttaattccac tggtgtgccc aacagtacta
    3901  attcttcatt ctctgtgggc accgttgttg cattgactag ggttcgtatg
    3951  acgattactc gctgctctcc tgaaactgcc tacctcgcct agagatttaa
    4001  ttcactatac tccaaaatcc ggtctccctt cttcctagct gttctc