Sequence of DPV Melon necrotic spot virus

Melon necrotic spot virus CP gene for coat protein, complete cds, isolate:si.

ACC No: AB044703

Dated: 2005-04-14 | Length: 1173 | CRC: 1321577206

                !!NA_SEQUENCE 1.0
ID   AB044703   standard; genomic RNA; VRL; 1173 BP.
XX
AC   AB044703;
XX
SV   AB044703.1
XX
DT   21-DEC-2000 (Rel. 66, Created)
DT   14-APR-2005 (Rel. 83, Last updated, Version 3)
XX
DE   Melon necrotic spot virus CP gene for coat protein, complete cds,
DE   isolate:si.
XX
KW   .
XX
OS   Melon necrotic spot virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Carmovirus.
XX
RN   [1]
RP   1-1173
RA   Oyama M., Hanada K., Sakai J.;
RT   ;
RL   Submitted (14-JUN-2000) to the EMBL/GenBank/DDBJ databases.
RL   Maki Oyama, KYOWASEED CO.,LTD., chonan research station; 377 chonan-machi
RL   ozawa, chosei, chiba 297-0142, Japan (E-mail:oyama@kqc.kyowaseed.co.jp,
RL   Tel:81-475-46-0212, Fax:81-475-46-1107)
XX
RN   [2]
RA   Oyama M., Sakai J., Aihara H., Hanada K.;
RT   "Comparison of nucleotide sequence of coat protein gene of six MNSV
RT   isolates found in West Japan";
RL   Unpublished.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1173
FT                   /country="Japan:shimane"
FT                   /db_xref="taxon:11987"
FT                   /mol_type="genomic RNA"
FT                   /organism="Melon necrotic spot virus"
FT                   /isolate="si"
FT   CDS             1. .1173
FT                   /codon_start=1
FT                   /db_xref="GOA:Q9DTZ8"
FT                   /db_xref="HSSP:2TBV"
FT                   /db_xref="InterPro:IPR000937"
FT                   /db_xref="UniProt/TrEMBL:Q9DTZ8"
FT                   /transl_table=1
FT                   /gene="CP"
FT                   /product="coat protein"
FT                   /protein_id="BAB19652.1"
FT                   /translation="MAMVKRINNLPTVKLAKQALPLLTNPKIVNKAIDVVPLVVQGGQK
FT                   LSKAAKRLLGAYGGNISYTEGAKPGAISAPVAISRRVAGMKPRFVRSEGSVKIVHREFI
FT                   ASVLPSNDLTVNNGDVNIGKYRVNPSNNALFTWLQGQAQLYDMYRFTRLRFTYIPTTGS
FT                   TSTGRVSILWDRDSQDPLPIDRAAISSYAHYADSAPWAENVLVVPCDNTWRYMNDTNAV
FT                   DRKLVDFGQFLFATYSGAGATAHGDLYVEYAVEFKDPQPIAGMVCMFDRLVSFSEVGST
FT                   IKGVNYIADRDVITTGGNIGVNINIPGTYLVTIVLNATSIGSLTFTGNSKLVGNSLNVT
FT                   SSGASALTFTLNSTGVPNSTNSSFSMGTVVALTRVRMTITRCSPETAYQA"
XX
SQ   Sequence 1173 BP; 280 A; 264 C; 268 G; 361 T; 0 other;

 AB044703  Length: 1173  April 19, 2005 08:51  Type: N  Check: 1151  ..

       1  atggcgatgg ttaaacgcat taataattta ccaacagtga agcttgctaa
      51  gcaggccctg cccctgttaa cgaatcctaa aattgtgaat aaggctatag
     101  atgtggttcc tttggtcgtc caaggtggtc agaaattgtc caaagctgcc
     151  aagcggttgc ttggcgctta tggtggtaat atttcttaca ctgagggtgc
     201  taagcctggt gcaatatccg ctccagttgc cataagtagg cgagtggcgg
     251  gtatgaagcc taggtttgtt cgatccgaag gatcagtgaa gatagttcat
     301  agggagttta ttgcctctgt tcttccgtcg aatgatctca ccgtgaataa
     351  tggtgatgtc aatatcggta agtatagggt caatcccagt aataacgctt
     401  tattcacatg gcttcaggga caagcgcaat tatatgatat gtacagattt
     451  actcgactac gatttaccta tattccaacc accggatcca cttccacagg
     501  tcgtgtttct attctctggg atagagactc tcaggatccc ctccctattg
     551  accgcgccgc tattagttct tatgctcatt acgctgattc agcgccttgg
     601  gcagagaacg ttttagtggt tccatgcgac aatacgtgga ggtacatgaa
     651  tgataccaac gcagtggacc ggaagttggt tgattttggg cagttcctct
     701  ttgctactta ttctggtgct ggtgctaccg cccatggtga tctctacgtt
     751  gagtatgctg ttgaattcaa agatccccag cctattgctg gaatggtttg
     801  tatgtttgat cgcttggtct ctttctctga agtcggatct acaattaaag
     851  gagtcaatta tattgctgat cgtgacgtga taaccactgg gggcaatatt
     901  ggtgtcaata tcaatattcc cgggacttat ctcgttacga ttgttcttaa
     951  cgctacatca attggctccc ttaccttcac tggtaattct aaactcgtag
    1001  gcaatagtct taacgtcact agcagtggcg cgtcagctct tacattcacc
    1051  ctcaattcca ctggtgtgcc caacagtact aattcttcat tctctatggg
    1101  caccgttgtt gcattgacta gggttcgtat gacgattact cgctgctctc
    1151  ctgaaactgc ctaccaagcc taa