Sequence of DPV Melon necrotic spot virus

Melon necrotic spot virus CP gene for coat protein, complete cds, isolate:YF.

ACC No: AB044704

Dated: 2005-04-14 | Length: 1173 | CRC: -1558691824

                !!NA_SEQUENCE 1.0
ID   AB044704   standard; genomic RNA; VRL; 1173 BP.
XX
AC   AB044704;
XX
SV   AB044704.1
XX
DT   21-DEC-2000 (Rel. 66, Created)
DT   14-APR-2005 (Rel. 83, Last updated, Version 3)
XX
DE   Melon necrotic spot virus CP gene for coat protein, complete cds,
DE   isolate:YF.
XX
KW   .
XX
OS   Melon necrotic spot virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Carmovirus.
XX
RN   [1]
RP   1-1173
RA   Oyama M., Hanada K., Sakai J.;
RT   ;
RL   Submitted (14-JUN-2000) to the EMBL/GenBank/DDBJ databases.
RL   Maki Oyama, KYOWASEED CO.,LTD., chonan research station; 377 chonan-machi
RL   ozawa, chosei, chiba 297-0142, Japan (E-mail:oyama@kqc.kyowaseed.co.jp,
RL   Tel:81-475-46-0212, Fax:81-475-46-1107)
XX
RN   [2]
RA   Oyama M., Sakai J., Aihara H., Hanada K.;
RT   "Comparison of nucleotide sequence of coat protein gene of six MNSV
RT   isolates found in West Japan";
RL   Unpublished.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1173
FT                   /country="Japan:yamaguchi"
FT                   /db_xref="taxon:11987"
FT                   /mol_type="genomic RNA"
FT                   /organism="Melon necrotic spot virus"
FT                   /isolate="YF"
FT   CDS             1. .1173
FT                   /codon_start=1
FT                   /db_xref="GOA:Q9DTZ7"
FT                   /db_xref="HSSP:2TBV"
FT                   /db_xref="InterPro:IPR000937"
FT                   /db_xref="UniProt/TrEMBL:Q9DTZ7"
FT                   /transl_table=1
FT                   /gene="CP"
FT                   /product="coat protein"
FT                   /protein_id="BAB19653.1"
FT                   /translation="MAMVKRINNLPTVKLAKQALPLLTNPKIVNKAIDVVPLVVQGGQK
FT                   LSKAAKRLLGAYGGNISYTEGAKPGAISAPVAISRRVAGMKPRFVRSEGSVKIVHREFI
FT                   ASVLPSNDLTVNNGDVDIGKYRVNPSNNALFTWLQGQAQLYDMYRFTRLRFTYIPTTGS
FT                   TSTGRVSILWDRDSQDPLPIDRAAISSYAHYADSAPWAENVLVVPCDNTWRYMNDTNAV
FT                   DRKLVDFGQFLFATYSGAGATAHGDLYVEYAVEFKDPQPIAGMVCMFDRLVSFSEVGST
FT                   IKGVNYIVDRDVITTGGNIGVNINIPGTYLVTIVLNATSIGSLTFTGNSKLVGNSLNVT
FT                   SSGASALTFTLNSTGVPNSTNSSFSVGTVVALTRVRMTITRCSPETAYLA"
XX
SQ   Sequence 1173 BP; 271 A; 271 C; 271 G; 360 T; 0 other;

  AB044704  Length: 1173  April 19, 2005 08:51  Type: N  Check: 36  ..

       1  atggcgatgg ttaaacgcat taataattta ccgacagtga agcttgctaa
      51  gcaggccctg cccctgctaa cgaatcctaa aattgtgaat aaggcgatag
     101  atgtggttcc tttggtcgtc caaggtggtc agaaattgtc caaagctgcc
     151  aagcggttgc ttggcgctta tggtggtaat atttcttaca ctgagggcgc
     201  taagcctggt gcaatatccg ctccagttgc cattagtagg cgagtggcgg
     251  gtatgaaacc taggtttgtt cgatccgaag gatctgtgaa gatagttcat
     301  agggagttta ttgcctctgt tcttccgtcg aatgatctca ccgtgaataa
     351  tggtgatgtc gatatcggta agtatagggt caatcccagt aataacgctt
     401  tattcacatg gcttcaggga caagcgcaat tgtatgatat gtacagattt
     451  actcgacttc gatttaccta tattccaacc accggatcca cttccacagg
     501  tcgtgtttct attctctggg atagagactc tcaggatccc ctccctattg
     551  accgcgccgc cattagttct tatgctcatt acgctgattc agcgccttgg
     601  gcagagaacg ttttagtggt tccgtgtgac aatacgtgga ggtatatgaa
     651  tgataccaat gcagtggacc ggaagttggt cgattttggg cagttcctct
     701  ttgctactta ttctggtgct ggtgccaccg cccacggtga tctctacgtt
     751  gagtacgctg ttgaattcaa agatccccag cctattgctg gaatggtttg
     801  tatgtttgat cgcttggtct ctttctctga agtcggatct acaattaaag
     851  gagtcaatta cattgttgat cgtgacgtga taaccactgg aggcaatatt
     901  ggtgttaata tcaatattcc tgggacttat ctcgtcacga ttgttcttaa
     951  tgccacttca attggctccc ttaccttcac tggcaattct aaactcgtag
    1001  gcaatagtct taacgttacc agcagcggcg cttcagctct tacattcacc
    1051  cttaattcca ctggtgtgcc caacagtacc aattcttcat tctctgtggg
    1101  caccgtcgtt gcattgacta gggttcgtat gacgattact cgctgctctc
    1151  ctgaaactgc ctacctcgcc taa